| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.128: Terpenoid synthases [48575] (1 superfamily) multihelical; core: 8 helices (C-J) are arranged in 2 parallel layers |
Superfamily a.128.1: Terpenoid synthases [48576] (6 families) ![]() duplication: two metal-binding sites are related by a pseudo dyad that also relates helices C-F to helices G-J |
| Family a.128.1.0: automated matches [196408] (1 protein) not a true family |
| Protein automated matches [196409] (46 species) not a true protein |
| Species Streptococcus uberis [TaxId:218495] [235348] (2 PDB entries) |
| Domain d4lfga1: 4lfg A:1-289 [253575] Other proteins in same PDB: d4lfga2 automated match to d4lfea_ complexed with ipe, mg |
PDB Entry: 4lfg (more details), 1.76 Å
SCOPe Domain Sequences for d4lfga1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4lfga1 a.128.1.0 (A:1-289) automated matches {Streptococcus uberis [TaxId: 218495]}
mdklkkidqtihafycekaviseklneavlysinaggkrirpilfleviealqipltesh
fkaaaalemihtgslihddlpamdnddyrrgqltnhkkfdeatailagdslfldafgmla
etdfptdvtvdlvrslssasgtfgmvggqmldmaaegkklnlknlqlihrhktgqllayp
fwaaarvaqldenllatfleigmiiglafqvrddilditanfeeigktpkkdvmaekmty
phllglnesyqildesldqaeailrklsdeiafapqkilslierlrlda
Timeline for d4lfga1: