Lineage for d4lfga1 (4lfg A:1-289)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2731436Fold a.128: Terpenoid synthases [48575] (1 superfamily)
    multihelical; core: 8 helices (C-J) are arranged in 2 parallel layers
  4. 2731437Superfamily a.128.1: Terpenoid synthases [48576] (6 families) (S)
    duplication: two metal-binding sites are related by a pseudo dyad that also relates helices C-F to helices G-J
  5. 2731887Family a.128.1.0: automated matches [196408] (1 protein)
    not a true family
  6. 2731888Protein automated matches [196409] (46 species)
    not a true protein
  7. 2732050Species Streptococcus uberis [TaxId:218495] [235348] (2 PDB entries)
  8. 2732053Domain d4lfga1: 4lfg A:1-289 [253575]
    Other proteins in same PDB: d4lfga2
    automated match to d4lfea_
    complexed with ipe, mg

Details for d4lfga1

PDB Entry: 4lfg (more details), 1.76 Å

PDB Description: crystal structure of geranylgeranyl diphosphate synthase sub1274 (target efi-509455) from streptococcus uberis 0140j with bound magnesium and isopentyl diphosphate, fully liganded complex;
PDB Compounds: (A:) Geranylgeranyl diphosphate synthase

SCOPe Domain Sequences for d4lfga1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4lfga1 a.128.1.0 (A:1-289) automated matches {Streptococcus uberis [TaxId: 218495]}
mdklkkidqtihafycekaviseklneavlysinaggkrirpilfleviealqipltesh
fkaaaalemihtgslihddlpamdnddyrrgqltnhkkfdeatailagdslfldafgmla
etdfptdvtvdlvrslssasgtfgmvggqmldmaaegkklnlknlqlihrhktgqllayp
fwaaarvaqldenllatfleigmiiglafqvrddilditanfeeigktpkkdvmaekmty
phllglnesyqildesldqaeailrklsdeiafapqkilslierlrlda

SCOPe Domain Coordinates for d4lfga1:

Click to download the PDB-style file with coordinates for d4lfga1.
(The format of our PDB-style files is described here.)

Timeline for d4lfga1:

View in 3D
Domains from same chain:
(mouse over for more information)
d4lfga2
View in 3D
Domains from other chains:
(mouse over for more information)
d4lfgb_