SCOPe 2.04: Domain d4le5b2: 4le5 B:110-243

Lineage for d4le5b2 (4le5 B:110-243)

1. Root: SCOPe 2.04

2. Class d: Alpha and beta proteins (a+b) [53931] (380 folds)

3. Fold d.130: S-adenosylmethionine synthetase [55972] (1 superfamily)
   duplication: consists of 3 similar intertwined domains
   structural repeat: beta-alpha-beta(2)-alpha-beta; two layers, alpha/beta

4. Superfamily d.130.1: S-adenosylmethionine synthetase [55973] (2 families)

5. Family d.130.1.0: automated matches [254267] (1 protein)
   not a true family

6. Protein automated matches [254617] (8 species)
   not a true protein

7. Species Campylobacter jejuni [TaxId:195099] [256355] (1 PDB entry)

8. Domain d4le5b2: 4le5 B:110-243 [253568]
   automated match to d1rg9a2

Details for d4le5b2

PDB Entry: 4le5, 1.7 Å

PDB Description: Structure of an Unusual S-adenosylmethionine synthetase from Campylobacter jejuni

PDB Compounds: (B:) s-adenosylmethionine synthetase

SCOPe Domain Sequences for d4le5b2:

Sequence, based on SEQRES records:

>d4le5b2 d.130.1.0 (B:110-243) automated matches {Campylobacter jejuni [TaxId: 195099]}
nqgvdqedgetgagdqgimfgfasceaeeympaaisyarmlcdrvyayakanphelgvdi
ktqvtidygtkanfenckpqsihtivvsapcvesmkiedlrslvmklildsnlpkelfdp
nktrilinptgkyv

Sequence, based on observed residues (ATOM records):

>d4le5b2 d.130.1.0 (B:110-243) automated matches {Campylobacter jejuni [TaxId: 195099]}
nqdqgimfgfasceaeeympaaisyarmlcdrvyayakanphelgvdiktqvtidygtka
nfenckpqsihtivvsapcvesmkiedlrslvmklildsnlpkelfdpnktrilinptgk
yv

Timeline for d4le5b2:

• d4le5b2 is new in SCOPe 2.04-stable
  
• d4le5b2 appears in SCOPe 2.05
  
• d4le5b2 appears in the current release, SCOPe 2.08