Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.130: S-adenosylmethionine synthetase [55972] (1 superfamily) duplication: consists of 3 similar intertwined domains structural repeat: beta-alpha-beta(2)-alpha-beta; two layers, alpha/beta |
Superfamily d.130.1: S-adenosylmethionine synthetase [55973] (2 families) |
Family d.130.1.0: automated matches [254267] (1 protein) not a true family |
Protein automated matches [254617] (15 species) not a true protein |
Species Campylobacter jejuni [TaxId:195099] [256355] (1 PDB entry) |
Domain d4le5b2: 4le5 B:110-243 [253568] Other proteins in same PDB: d4le5a4 automated match to d1rg9a2 |
PDB Entry: 4le5 (more details), 1.7 Å
SCOPe Domain Sequences for d4le5b2:
Sequence, based on SEQRES records: (download)
>d4le5b2 d.130.1.0 (B:110-243) automated matches {Campylobacter jejuni [TaxId: 195099]} nqgvdqedgetgagdqgimfgfasceaeeympaaisyarmlcdrvyayakanphelgvdi ktqvtidygtkanfenckpqsihtivvsapcvesmkiedlrslvmklildsnlpkelfdp nktrilinptgkyv
>d4le5b2 d.130.1.0 (B:110-243) automated matches {Campylobacter jejuni [TaxId: 195099]} nqdqgimfgfasceaeeympaaisyarmlcdrvyayakanphelgvdiktqvtidygtka nfenckpqsihtivvsapcvesmkiedlrslvmklildsnlpkelfdpnktrilinptgk yv
Timeline for d4le5b2:
View in 3D Domains from other chains: (mouse over for more information) d4le5a1, d4le5a2, d4le5a3, d4le5a4 |