Lineage for d4le5a1 (4le5 A:1-106)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2976292Fold d.130: S-adenosylmethionine synthetase [55972] (1 superfamily)
    duplication: consists of 3 similar intertwined domains
    structural repeat: beta-alpha-beta(2)-alpha-beta; two layers, alpha/beta
  4. 2976293Superfamily d.130.1: S-adenosylmethionine synthetase [55973] (2 families) (S)
  5. 2976427Family d.130.1.0: automated matches [254267] (1 protein)
    not a true family
  6. 2976428Protein automated matches [254617] (15 species)
    not a true protein
  7. 2976441Species Campylobacter jejuni [TaxId:195099] [256355] (1 PDB entry)
  8. 2976442Domain d4le5a1: 4le5 A:1-106 [253564]
    Other proteins in same PDB: d4le5a4
    automated match to d1mxaa1

Details for d4le5a1

PDB Entry: 4le5 (more details), 1.7 Å

PDB Description: Structure of an Unusual S-adenosylmethionine synthetase from Campylobacter jejuni
PDB Compounds: (A:) s-adenosylmethionine synthetase

SCOPe Domain Sequences for d4le5a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4le5a1 d.130.1.0 (A:1-106) automated matches {Campylobacter jejuni [TaxId: 195099]}
mylftsevvsaghpdkcadiiadtivdillkndknsrvasevfvagnkvviggevksnhk
lskadydnlvkdvlknigydgaghfskeqclhpdevdvmvflneqs

SCOPe Domain Coordinates for d4le5a1:

Click to download the PDB-style file with coordinates for d4le5a1.
(The format of our PDB-style files is described here.)

Timeline for d4le5a1: