Lineage for d4le5a3 (4le5 A:244-398)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2582825Fold d.130: S-adenosylmethionine synthetase [55972] (1 superfamily)
    duplication: consists of 3 similar intertwined domains
    structural repeat: beta-alpha-beta(2)-alpha-beta; two layers, alpha/beta
  4. 2582826Superfamily d.130.1: S-adenosylmethionine synthetase [55973] (2 families) (S)
  5. 2582960Family d.130.1.0: automated matches [254267] (1 protein)
    not a true family
  6. 2582961Protein automated matches [254617] (15 species)
    not a true protein
  7. 2583011Species Campylobacter jejuni [TaxId:195099] [256355] (1 PDB entry)
  8. 2583014Domain d4le5a3: 4le5 A:244-398 [253566]
    Other proteins in same PDB: d4le5a4
    automated match to d1mxaa3

Details for d4le5a3

PDB Entry: 4le5 (more details), 1.7 Å

PDB Description: Structure of an Unusual S-adenosylmethionine synthetase from Campylobacter jejuni
PDB Compounds: (A:) s-adenosylmethionine synthetase

SCOPe Domain Sequences for d4le5a3:

Sequence; same for both SEQRES and ATOM records: (download)

>d4le5a3 d.130.1.0 (A:244-398) automated matches {Campylobacter jejuni [TaxId: 195099]}
nhsslhdsgltgrklivdsfggyspigggaqsskdytkvdrsglyagrwlaknivaagla
kkcivqlsyaigvakptsvsvdcmgtntsvnddvlsdfvmqnfsltpnwirdkfhldkps
ketflyadvaargqvgqkdypwekldaleqfkkll

SCOPe Domain Coordinates for d4le5a3:

Click to download the PDB-style file with coordinates for d4le5a3.
(The format of our PDB-style files is described here.)

Timeline for d4le5a3: