![]() | Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
![]() | Fold d.130: S-adenosylmethionine synthetase [55972] (1 superfamily) duplication: consists of 3 similar intertwined domains structural repeat: beta-alpha-beta(2)-alpha-beta; two layers, alpha/beta |
![]() | Superfamily d.130.1: S-adenosylmethionine synthetase [55973] (2 families) ![]() |
![]() | Family d.130.1.0: automated matches [254267] (1 protein) not a true family |
![]() | Protein automated matches [254617] (15 species) not a true protein |
![]() | Species Campylobacter jejuni [TaxId:195099] [256355] (1 PDB entry) |
![]() | Domain d4le5a2: 4le5 A:118-243 [253565] Other proteins in same PDB: d4le5a4 automated match to d1rg9a2 |
PDB Entry: 4le5 (more details), 1.7 Å
SCOPe Domain Sequences for d4le5a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d4le5a2 d.130.1.0 (A:118-243) automated matches {Campylobacter jejuni [TaxId: 195099]} getgagdqgimfgfasceaeeympaaisyarmlcdrvyayakanphelgvdiktqvtidy gtkanfenckpqsihtivvsapcvesmkiedlrslvmklildsnlpkelfdpnktrilin ptgkyv
Timeline for d4le5a2: