Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families) division into families based on beta-sheet topologies |
Family c.37.1.8: G proteins [52592] (81 proteins) core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest |
Protein automated matches [190047] (37 species) not a true protein |
Species Thermus thermophilus [TaxId:274] [256283] (6 PDB entries) |
Domain d4lc0a1: 4lc0 A:3-212 [253545] Other proteins in same PDB: d4lc0a2, d4lc0a3 automated match to d1b23p3 complexed with gnp, mg, nh4, so4 |
PDB Entry: 4lc0 (more details), 2.22 Å
SCOPe Domain Sequences for d4lc0a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4lc0a1 c.37.1.8 (A:3-212) automated matches {Thermus thermophilus [TaxId: 274]} gefvrtkphvnvgtighvdhgkttltaaltyvaaaenpnvevkdygdidkapeerargit intahveyetakrhyshvdcpghadyiknmitgaaqmdgailvvsaadgpmpqtrehill arqvgvpyivvfmnkvdmvddpelldlvemevrdllnqyefpgdevpvirgsallaleqm hrnpktrrgenewvdkiwelldaideyipt
Timeline for d4lc0a1: