Class b: All beta proteins [48724] (180 folds) |
Fold b.44: Elongation factor/aminomethyltransferase common domain [50464] (2 superfamilies) barrel, closed; n=6, S=10; greek-key |
Superfamily b.44.1: EF-Tu/eEF-1alpha/eIF2-gamma C-terminal domain [50465] (2 families) probably related to the second domain and its superfamiy by a circular permutation |
Family b.44.1.0: automated matches [254194] (1 protein) not a true family |
Protein automated matches [254425] (18 species) not a true protein |
Species Thermus thermophilus [TaxId:274] [256285] (6 PDB entries) |
Domain d4lbva3: 4lbv A:313-405 [253535] Other proteins in same PDB: d4lbva1, d4lbva2 automated match to d1b23p2 complexed with cl, gnp, mg, nh4, so4 |
PDB Entry: 4lbv (more details), 2.03 Å
SCOPe Domain Sequences for d4lbva3:
Sequence; same for both SEQRES and ATOM records: (download)
>d4lbva3 b.44.1.0 (A:313-405) automated matches {Thermus thermophilus [TaxId: 274]} htkfeasvyvlkkeeggrhtgffsgyrpqfyfrttdvtgvvqlppgvemvmpgdnvtftv elikpvaleeglrfaireggrtvgagvvtkile
Timeline for d4lbva3: