Lineage for d4lbva2 (4lbv A:213-312)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2792909Fold b.43: Reductase/isomerase/elongation factor common domain [50412] (4 superfamilies)
    barrel, closed; n=6, S=10; greek-key
  4. 2792984Superfamily b.43.3: Translation proteins [50447] (7 families) (S)
  5. 2793298Family b.43.3.0: automated matches [227211] (1 protein)
    not a true family
  6. 2793299Protein automated matches [226946] (29 species)
    not a true protein
  7. 2793449Species Thermus thermophilus [TaxId:274] [256284] (6 PDB entries)
  8. 2793455Domain d4lbva2: 4lbv A:213-312 [253534]
    Other proteins in same PDB: d4lbva1, d4lbva3
    automated match to d1b23p1
    complexed with cl, gnp, mg, nh4, so4

Details for d4lbva2

PDB Entry: 4lbv (more details), 2.03 Å

PDB Description: identifying ligand binding hot spots in proteins using brominated fragments
PDB Compounds: (A:) elongation factor tu-a

SCOPe Domain Sequences for d4lbva2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4lbva2 b.43.3.0 (A:213-312) automated matches {Thermus thermophilus [TaxId: 274]}
pvrdvdkpflmpvedvftitgrgtvatgriergkvkvgdeveivglapetrktvvtgvem
hrktlqegiagdnvgvllrgvsreevergqvlakpgsitp

SCOPe Domain Coordinates for d4lbva2:

Click to download the PDB-style file with coordinates for d4lbva2.
(The format of our PDB-style files is described here.)

Timeline for d4lbva2: