Lineage for d4klye1 (4kly E:21-250)

  1. Root: SCOPe 2.07
  2. 2626587Class f: Membrane and cell surface proteins and peptides [56835] (60 folds)
  3. 2628564Fold f.13: Class A G protein-coupled receptor (GPCR)-like [81322] (1 superfamily)
    core: up-and-down bundle of seven transmembrane helices tilted 20 degrees with respect to the plane of the membrane
  4. 2628565Superfamily f.13.1: Class A G protein-coupled receptor (GPCR)-like [81321] (5 families) (S)
    Pfam PF13853. Phylogeny described in PubMed 12761335
  5. 2628891Family f.13.1.0: automated matches [227143] (1 protein)
    not a true family
  6. 2628892Protein automated matches [226845] (23 species)
    not a true protein
  7. 2628903Species Gamma proteobacterium [TaxId:245185] [256343] (2 PDB entries)
  8. 2628913Domain d4klye1: 4kly E:21-250 [253340]
    Other proteins in same PDB: d4klya2, d4klyb2, d4klyc2, d4klyd2, d4klye2
    automated match to d4jq6a_
    complexed with ret; mutant

Details for d4klye1

PDB Entry: 4kly (more details), 2.7 Å

PDB Description: Crystal structure of a blue-light absorbing proteorhodopsin mutant D97N from HOT75
PDB Compounds: (E:) Blue-light absorbing proteorhodopsin

SCOPe Domain Sequences for d4klye1:

Sequence, based on SEQRES records: (download)

>d4klye1 f.13.1.0 (E:21-250) automated matches {Gamma proteobacterium [TaxId: 245185]}
gdldisdtvgvsfwlvtagmlaatvfffverdqvsakwktsltvsglitgiafwhylymr
gvwidtgdtptvfryinwlltvplqvvefylilaactsvaaslfkkllagslvmlgagfa
geaglapvlpafiigmagwlymiyelymgegkaavstaspavnsaynammmiivvgwaiy
pagyaagylmggegvyasnlnliynladfvnkilfgliiwnvavkessna

Sequence, based on observed residues (ATOM records): (download)

>d4klye1 f.13.1.0 (E:21-250) automated matches {Gamma proteobacterium [TaxId: 245185]}
gdldisdtvgvsfwlvtagmlaatvfffverdqvsakwktsltvsglitgiafwhylymr
gvwidtgdtptvfryinwlltvplqvvefylilaactsvaaslfkkllagslvmlgagfa
geaglapvlpafiigmagwlymiyelymgegktaspavnsaynammmiivvgwaiypagy
aagylmgvyasnlnliynladfvnkilfgliiwnvavkessna

SCOPe Domain Coordinates for d4klye1:

Click to download the PDB-style file with coordinates for d4klye1.
(The format of our PDB-style files is described here.)

Timeline for d4klye1: