SCOPe 2.07: Domain d4klyd1: 4kly D:20-250

Lineage for d4klyd1 (4kly D:20-250)

1. Root: SCOPe 2.07

2. Class f: Membrane and cell surface proteins and peptides [56835] (60 folds)

3. Fold f.13: Class A G protein-coupled receptor (GPCR)-like [81322] (1 superfamily)
   core: up-and-down bundle of seven transmembrane helices tilted 20 degrees with respect to the plane of the membrane

4. Superfamily f.13.1: Class A G protein-coupled receptor (GPCR)-like [81321] (5 families)
   Pfam PF13853. Phylogeny described in PubMed 12761335

5. Family f.13.1.0: automated matches [227143] (1 protein)
   not a true family

6. Protein automated matches [226845] (23 species)
   not a true protein

7. Species Gamma proteobacterium [TaxId:245185] [256343] (2 PDB entries)

8. Domain d4klyd1: 4kly D:20-250 [253339]
   Other proteins in same PDB: d4klya2, d4klyb2, d4klyc2, d4klyd2, d4klye2
   automated match to d4jq6a_
   complexed with ret; mutant

Details for d4klyd1

PDB Entry: 4kly, 2.7 Å

PDB Description: Crystal structure of a blue-light absorbing proteorhodopsin mutant D97N from HOT75

PDB Compounds: (D:) Blue-light absorbing proteorhodopsin

SCOPe Domain Sequences for d4klyd1:

Sequence, based on SEQRES records:

>d4klyd1 f.13.1.0 (D:20-250) automated matches {Gamma proteobacterium [TaxId: 245185]}
ggdldisdtvgvsfwlvtagmlaatvfffverdqvsakwktsltvsglitgiafwhylym
rgvwidtgdtptvfryinwlltvplqvvefylilaactsvaaslfkkllagslvmlgagf
ageaglapvlpafiigmagwlymiyelymgegkaavstaspavnsaynammmiivvgwai
ypagyaagylmggegvyasnlnliynladfvnkilfgliiwnvavkessna

Sequence, based on observed residues (ATOM records):

>d4klyd1 f.13.1.0 (D:20-250) automated matches {Gamma proteobacterium [TaxId: 245185]}
ggdldisdtvgvsfwlvtagmlaatvfffverdqvsakwktsltvsglitgiafwhylym
rgvwidtgdtptvfryinwlltvplqvvefylilasvaaslfkkllagslvmlgagfage
aglapvlpafiigmagwlymiyelymgegspavnsaynammmiivvgwaiypagyaagyl
mgvyasnlnliynladfvnkilfgliiwnvavkessna

Timeline for d4klyd1:

• d4klyd1 first appeared in SCOPe 2.04, called d4klyd_
  
• d4klyd1 appears in SCOPe 2.06
  
• d4klyd1 appears in the current release, SCOPe 2.08