| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.36: Thiamin diphosphate-binding fold (THDP-binding) [52517] (1 superfamily) 3 layers: a/b/a; parallel beta-sheet of 6 strands, order 213465 |
Superfamily c.36.1: Thiamin diphosphate-binding fold (THDP-binding) [52518] (9 families) ![]() there are two different functional modules of this fold: pyridine-binding (Pyr) and pyrophosphate-binding (PP) modules two Pyr and two PP modules assemble together in a conserved heterotetrameric core that binds two THDP coenzyme molecules |
| Domain d4k9oc3: 4k9o C:342-525 [253204] Other proteins in same PDB: d4k9oa2, d4k9ob2, d4k9oc2, d4k9od2 automated match to d1q6za3 complexed with ca, gol, mg, tpp; mutant |
PDB Entry: 4k9o (more details), 1.89 Å
SCOPe Domain Sequences for d4k9oc3:
Sequence; same for both SEQRES and ATOM records: (download)
>d4k9oc3 c.36.1.0 (C:342-525) automated matches {Pseudomonas putida [TaxId: 303]}
epakvdqdagrlhpetvfdtlndmapenaiylneststtaqmwqrlnmrnpgsyyacaag
glgfalpaaigvqlaeperqviavigdgsanysisalwtaaqyniptifvimnngtygal
rwfagvleaenvpgldvpgidfralakgygvqalkadnleqlkgslqealsakgpvliev
stvs
Timeline for d4k9oc3: