| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.31: DHS-like NAD/FAD-binding domain [52466] (1 superfamily) 3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456; Rossmann-like |
Superfamily c.31.1: DHS-like NAD/FAD-binding domain [52467] (7 families) ![]() binds cofactor molecules in the opposite direction than classical Rossmann fold |
| Family c.31.1.3: Pyruvate oxidase and decarboxylase, middle domain [52475] (8 proteins) N-terminal domain is Pyr module, and C-terminal domain is PP module of thiamin diphosphate-binding fold |
| Protein Benzoylformate decarboxylase [52482] (1 species) |
| Species Pseudomonas putida [TaxId:303] [52483] (34 PDB entries) Uniprot P20906 |
| Domain d4k9ob2: 4k9o B:182-341 [253200] Other proteins in same PDB: d4k9oa1, d4k9oa3, d4k9ob1, d4k9ob3, d4k9oc1, d4k9oc3, d4k9od1, d4k9od3 automated match to d1q6za1 complexed with ca, gol, mg, tpp; mutant |
PDB Entry: 4k9o (more details), 1.89 Å
SCOPe Domain Sequences for d4k9ob2:
Sequence; same for both SEQRES and ATOM records: (download)
>d4k9ob2 c.31.1.3 (B:182-341) Benzoylformate decarboxylase {Pseudomonas putida [TaxId: 303]}
svrlndqdldilvkalnsasnpaivlgpdvdaananadcvmlaerlkapvwvapsaprcp
fptrhpcfrglmpagiaaisqlleghdvvlvigapvfryhqydpgqylkpgtrlisvtcd
pleaarapmgdaivadigamasalanlveessrqlptaap
Timeline for d4k9ob2: