SCOP 1.75: Domain d1quqa_: 1quq A:

Lineage for d1quqa_ (1quq A:)

1. Root: SCOP 1.75

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.40: OB-fold [50198] (16 superfamilies)
   barrel, closed or partly opened n=5, S=10 or S=8; greek-key

4. Superfamily b.40.4: Nucleic acid-binding proteins [50249] (16 families)

5. Family b.40.4.3: Single strand DNA-binding domain, SSB [50263] (12 proteins)
   barrel, closed; n=5, S=10

6. Protein Replication protein A 32 KDa subunit (RPA32) fragment [50269] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [50270] (5 PDB entries)

8. Domain d1quqa_: 1quq A: [25303]
   Other proteins in same PDB: d1quqb_, d1quqd_

Details for d1quqa_

PDB Entry: 1quq, 2.5 Å

PDB Description: complex of replication protein a subunits rpa14 and rpa32

PDB Compounds: (A:) protein (replication protein a 32 kd subunit)

SCOP Domain Sequences for d1quqa_:

Sequence, based on SEQRES records:

>d1quqa_ b.40.4.3 (A:) Replication protein A 32 KDa subunit (RPA32) fragment {Human (Homo sapiens) [TaxId: 9606]}
hivpctisqllsatlvdevfrignveisqvtivgiirhaekaptnivykiddmtaapmdv
rqwvdtddtssentvvppetyvkvaghlrsfqnkkslvafkimpledmneftthilevin
ahmvlsk

Sequence, based on observed residues (ATOM records):

>d1quqa_ b.40.4.3 (A:) Replication protein A 32 KDa subunit (RPA32) fragment {Human (Homo sapiens) [TaxId: 9606]}
hivpctisqllsatlvdevfrignveisqvtivgiirhaekaptnivykiddmtaapmdv
rqwvdtntvvppetyvkvaghlrsfqnkkslvafkimpledmneftthilevinahmvls
k

Timeline for d1quqa_:

• d1quqa_ first appeared (with stable ids) in SCOP 1.55
  
• d1quqa_ appears in SCOP 1.73
  
• d1quqa_ appears in SCOPe 2.01
  
• d1quqa_ appears in the current release, SCOPe 2.08