SCOPe 2.08: Domain d1eygb_: 1eyg B:

Lineage for d1eygb_ (1eyg B:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.40: OB-fold [50198] (17 superfamilies)
   barrel, closed or partly opened n=5, S=10 or S=8; greek-key

4. Superfamily b.40.4: Nucleic acid-binding proteins [50249] (18 families)

5. Family b.40.4.3: Single strand DNA-binding domain, SSB [50263] (14 proteins)
   barrel, closed; n=5, S=10

6. Protein ssDNA-binding protein [50264] (4 species)

7. Species Escherichia coli [TaxId:562] [50266] (6 PDB entries)
   Uniprot P02339

8. Domain d1eygb_: 1eyg B: [25293]
   protein/DNA complex
   has additional insertions and/or extensions that are not grouped together
   missing some secondary structures that made up less than one-third of the common domain

Details for d1eygb_

PDB Entry: 1eyg, 2.8 Å

PDB Description: Crystal structure of chymotryptic fragment of E. coli ssb bound to two 35-mer single strand DNAS

PDB Compounds: (B:) single-strand DNA-binding protein

SCOPe Domain Sequences for d1eygb_:

Sequence, based on SEQRES records:

>d1eygb_ b.40.4.3 (B:) ssDNA-binding protein {Escherichia coli [TaxId: 562]}
asrgvnkvilvgnlgqdpevrympnggavanitlatseswrdkatgemkeqtewhrvvlf
gklaevaseylrkgsqvyiegqlrtrkwtdqsgqdryttevvvnvggtmqmlg

Sequence, based on observed residues (ATOM records):

>d1eygb_ b.40.4.3 (B:) ssDNA-binding protein {Escherichia coli [TaxId: 562]}
asrgvnkvilvgnlgqdpevrympnggavanitlatsesweqtewhrvvlfgklaevase
ylrkgsqvyiegqlrtrkwtdqsgqdryttevvvnvggtmqmlg

Timeline for d1eygb_:

• d1eygb_ first appeared (with stable ids) in SCOP 1.55
  
• d1eygb_ appears in SCOPe 2.07