![]() | Class d: Alpha and beta proteins (a+b) [53931] (380 folds) |
![]() | Fold d.109: Gelsolin-like [55752] (3 superfamilies) 3 layers: a/b/a; contains mixed beta-sheet |
![]() | Superfamily d.109.1: Actin depolymerizing proteins [55753] (3 families) ![]() |
![]() | Family d.109.1.2: Cofilin-like [55762] (8 proteins) |
![]() | Protein automated matches [190045] (5 species) not a true protein |
![]() | Species Mouse (Mus musculus) [TaxId:10090] [256328] (1 PDB entry) |
![]() | Domain d4jd2h_: 4jd2 H: [252898] Other proteins in same PDB: d4jd2a1, d4jd2a2, d4jd2c_, d4jd2d1, d4jd2d2, d4jd2e_, d4jd2f_, d4jd2g_ automated match to d1wfsa_ complexed with atp, ca, pg4 |
PDB Entry: 4jd2 (more details), 3.08 Å
SCOPe Domain Sequences for d4jd2h_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4jd2h_ d.109.1.2 (H:) automated matches {Mouse (Mus musculus) [TaxId: 10090]} dslvvcevdpelketlrkfrfrketnnaaiimkvdkdrqmvvledelqnispeelklelp erqprfvvysykyvhddgrvsyplcfifsspvgckpeqqmmyagsknrlvqtaeltkvfe irttddltetwlkeklaf
Timeline for d4jd2h_: