Lineage for d4jd2g_ (4jd2 G:)

  1. Root: SCOPe 2.04
  2. 1473060Class a: All alpha proteins [46456] (285 folds)
  3. Fold a.118: alpha-alpha superhelix [48370] (24 superfamilies)
    multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
  4. 1501880Superfamily a.118.13: Arp2/3 complex 16 kDa subunit ARPC5 [69103] (1 family) (S)
    automatically mapped to Pfam PF04699
  5. 1501881Family a.118.13.1: Arp2/3 complex 16 kDa subunit ARPC5 [69104] (2 proteins)
  6. 1501887Protein automated matches [190348] (1 species)
    not a true protein
  7. 1501888Species Cow (Bos taurus) [TaxId:9913] [187175] (14 PDB entries)
  8. 1501897Domain d4jd2g_: 4jd2 G: [252897]
    Other proteins in same PDB: d4jd2a1, d4jd2a2, d4jd2c_, d4jd2d1, d4jd2d2, d4jd2e_, d4jd2f_, d4jd2h_
    automated match to d3ukug_
    complexed with atp, ca, pg4

Details for d4jd2g_

PDB Entry: 4jd2 (more details), 3.08 Å

PDB Description: Crystal structure of Bos taurus Arp2/3 complex binding with Mus musculus GMF
PDB Compounds: (G:) Actin-related protein 2/3 complex subunit 5

SCOPe Domain Sequences for d4jd2g_:

Sequence, based on SEQRES records: (download)

>d4jd2g_ a.118.13.1 (G:) automated matches {Cow (Bos taurus) [TaxId: 9913]}
arfrkvdvgeydenkfvdeedggdgqagpdegevdsclrqgnmtaalqaalknppintks
qavkdragsivlkvlisfkandiekavqsldkngvdllmkyiykgfespsdnssavllqw
hekalaaggvgsivrvltarktv

Sequence, based on observed residues (ATOM records): (download)

>d4jd2g_ a.118.13.1 (G:) automated matches {Cow (Bos taurus) [TaxId: 9913]}
arfrkvdvgeydenkfvdeegdggpdegevdsclrqgnmtaalqaalknppintksqavk
dragsivlkvlisfkandiekavqsldkngvdllmkyiykgfespsdnssavllqwheka
laaggvgsivrvltarktv

SCOPe Domain Coordinates for d4jd2g_:

Click to download the PDB-style file with coordinates for d4jd2g_.
(The format of our PDB-style files is described here.)

Timeline for d4jd2g_: