![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies) 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest |
![]() | Superfamily c.55.1: Actin-like ATPase domain [53067] (16 families) ![]() duplication contains two domains of this fold |
![]() | Family c.55.1.1: Actin/HSP70 [53068] (8 proteins) |
![]() | Protein automated matches [226905] (13 species) not a true protein |
![]() | Species Cow (Bos taurus) [TaxId:9913] [225259] (3 PDB entries) |
![]() | Domain d4jd2a2: 4jd2 A:161-416 [252891] Other proteins in same PDB: d4jd2a1, d4jd2c_, d4jd2d1, d4jd2d2, d4jd2e_, d4jd2f_, d4jd2g_, d4jd2h_ automated match to d1k8ka2 complexed with atp, ca, pg4 |
PDB Entry: 4jd2 (more details), 3.08 Å
SCOPe Domain Sequences for d4jd2a2:
Sequence, based on SEQRES records: (download)
>d4jd2a2 c.55.1.1 (A:161-416) automated matches {Cow (Bos taurus) [TaxId: 9913]} rtltgtvidsgdgvthvipvaegyvigscikhipiagrdityfiqqllrdrevgippeqs letakavkerysyvcpdlvkefnkydtdgskwikqytginaiskkefsidvgyerflgpe iffhpefanpdftqpisevvdeviqncpidvrrplyknivlsggstmfrdfgrrlqrdlk rtvdarlklseelsggrlkpkpidvqvithhmqryavwfggsmlastpefyqvchtkkdy eeigpsicrhnpvfgv
>d4jd2a2 c.55.1.1 (A:161-416) automated matches {Cow (Bos taurus) [TaxId: 9913]} rtltgtvidsgdgvthvipvaegyvigscikhipiagrdityfiqqllrdrevgippeqs letakavkerysyvcpdlvkefnkydtdgskwikqytginaiskkefsidvgyerflgpe iffhpefanpdftqpisevvdeviqncpidvrrplyknivlsggstmfrdfgrrlqrdlk rtvdarlklseelsgpkpidvqvithhmqryavwfggsmlastpefyqvchtkkdyeeig psicrhnpvfgv
Timeline for d4jd2a2: