Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.23: Flavodoxin-like [52171] (15 superfamilies) 3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345 |
Superfamily c.23.1: CheY-like [52172] (8 families) |
Family c.23.1.0: automated matches [191324] (1 protein) not a true family |
Protein automated matches [190131] (84 species) not a true protein |
Species Thermotoga maritima [TaxId:2336] [188956] (20 PDB entries) |
Domain d4jasb_: 4jas B: [252853] Other proteins in same PDB: d4jasa1, d4jasa2 automated match to d3dgec_ complexed with adp, mg; mutant |
PDB Entry: 4jas (more details), 3 Å
SCOPe Domain Sequences for d4jasb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4jasb_ c.23.1.0 (B:) automated matches {Thermotoga maritima [TaxId: 2336]} skkvllvddsapirkmvsfvlkkegyevieaengqialeklseftpdlivldimmpvmdg ftvlkklqekeewkripvivltakggeedeslalslgarkvmrkpfspsqfieevkhlln e
Timeline for d4jasb_: