Lineage for d4jasa1 (4jas A:244-320)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2322230Fold a.30: ROP-like [47379] (8 superfamilies)
    4 helices; dimer of identical alpha-hairpin subunits; bundle, closed, left-handed twist
  4. 2322270Superfamily a.30.2: Homodimeric domain of signal transducing histidine kinase [47384] (2 families) (S)
  5. 2322288Family a.30.2.0: automated matches [227712] (1 protein)
    not a true family
  6. 2322289Protein automated matches [227713] (2 species)
    not a true protein
  7. 2322305Species Thermotoga maritima [TaxId:243274] [227714] (7 PDB entries)
  8. 2322311Domain d4jasa1: 4jas A:244-320 [252851]
    Other proteins in same PDB: d4jasa2, d4jasb_
    automated match to d2c2aa1
    complexed with adp, mg; mutant

Details for d4jasa1

PDB Entry: 4jas (more details), 3 Å

PDB Description: Structural basis of a rationally rewired protein-protein interface (HK853mutant A268V, A271G, T275M, V294T and D297E and RR468mutant V13P, L14I, I17M and N21V)
PDB Compounds: (A:) Histidine kinase

SCOPe Domain Sequences for d4jasa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4jasa1 a.30.2.0 (A:244-320) automated matches {Thermotoga maritima [TaxId: 243274]}
lkridrmktefianishelrtpltvikgyaemiynslgeldlstlkefletiieqsnhle
nllnelldfsrlerksl

SCOPe Domain Coordinates for d4jasa1:

Click to download the PDB-style file with coordinates for d4jasa1.
(The format of our PDB-style files is described here.)

Timeline for d4jasa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d4jasa2
View in 3D
Domains from other chains:
(mouse over for more information)
d4jasb_