Class b: All beta proteins [48724] (177 folds) |
Fold b.44: Elongation factor/aminomethyltransferase common domain [50464] (2 superfamilies) barrel, closed; n=6, S=10; greek-key |
Superfamily b.44.1: EF-Tu/eEF-1alpha/eIF2-gamma C-terminal domain [50465] (2 families) probably related to the second domain and its superfamiy by a circular permutation |
Family b.44.1.0: automated matches [254194] (1 protein) not a true family |
Protein automated matches [254425] (16 species) not a true protein |
Species Pseudomonas putida [TaxId:160488] [256313] (2 PDB entries) |
Domain d4j0qe3: 4j0q E:305-397 [252795] Other proteins in same PDB: d4j0qa1, d4j0qa2, d4j0qb1, d4j0qb2, d4j0qc1, d4j0qc2, d4j0qd1, d4j0qd2, d4j0qe1, d4j0qe2 automated match to d1b23p2 complexed with gdp, mes, mg, mpd |
PDB Entry: 4j0q (more details), 2.29 Å
SCOPe Domain Sequences for d4j0qe3:
Sequence; same for both SEQRES and ATOM records: (download)
>d4j0qe3 b.44.1.0 (E:305-397) automated matches {Pseudomonas putida [TaxId: 160488]} htkftaevyvlskeeggrhtpffkgyrpqfyfrttdvtgncelpegvemvmpgdniqmtv tliktiamedglrfaireggrtvgagvvakiie
Timeline for d4j0qe3: