PDB entry 4j0q

View 4j0q on RCSB PDB site
Description: Crystal structure of Pseudomonas putida elongation factor Tu (EF-Tu)
Class: translation
Keywords: translation, GDP, GTP, GTPase, elongation, pseudomonas
Deposited on 2013-01-31, released 2014-02-05
The last revision prior to the SCOPe 2.06 freeze date was dated 2014-10-01, with a file datestamp of 2014-09-26.
Experiment type: XRAY
Resolution: 2.29 Å
R-factor: 0.174
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: elongation factor tu-a
    Species: Pseudomonas putida [TaxId:160488]
    Gene: PP_0440, tuf-1, tufA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4j0qa1, d4j0qa2, d4j0qa3
  • Chain 'B':
    Compound: elongation factor tu-a
    Species: Pseudomonas putida [TaxId:160488]
    Gene: PP_0440, tuf-1, tufA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4j0qb1, d4j0qb2, d4j0qb3
  • Chain 'C':
    Compound: elongation factor tu-a
    Species: Pseudomonas putida [TaxId:160488]
    Gene: PP_0440, tuf-1, tufA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4j0qc1, d4j0qc2, d4j0qc3
  • Chain 'D':
    Compound: elongation factor tu-a
    Species: Pseudomonas putida [TaxId:160488]
    Gene: PP_0440, tuf-1, tufA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4j0qd1, d4j0qd2, d4j0qd3
  • Chain 'E':
    Compound: elongation factor tu-a
    Species: Pseudomonas putida [TaxId:160488]
    Gene: PP_0440, tuf-1, tufA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4j0qe1, d4j0qe2, d4j0qe3
  • Heterogens: MG, GDP, MES, MPD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4j0qA (A:)
    mgsshhhhhhssglvprgshmasmtggqqmgrgsefmakekfdrslphvnvgtighvdhg
    kttltaaltrvcsevfgsaivefdkidsapeekargitintahveynstirhyahvdcpg
    hadyvknmitgaaqmdgailvcsaadgpmpqtrehillsrqvgvpyivvflnkadlvdda
    ellelvemevrdllstydfpgddtpiiigsarmalegkddnemgttavkklvetldsyip
    epvraidqpflmpiedvfsisgrgtvvtgriergivrvqdpleivglrdtttttctgvem
    frklldegragencgvllrgtkrddvergqvlvkpgsvkphtkftaevyvlskeeggrht
    pffkgyrpqfyfrttdvtgncelpegvemvmpgdniqmtvtliktiamedglrfairegg
    rtvgagvvakiie
    

    Sequence, based on observed residues (ATOM records): (download)
    >4j0qA (A:)
    slphvnvgtighvdhgkttltaaltrvcsevfgsagitintahveynstirhyahvdcpg
    hadyvknmitgaaqmdgailvcsaadgpmpqtrehillsrqvgvpyivvflnkadlvdda
    ellelvemevrdllstydfpgddtpiiigsarmalegkddnemgttavkklvetldsyip
    epvraidqpflmpiedvfsisgrgtvvtgriergivrvqdpleivglrdtttttctgvem
    frklldegragencgvllrgtkrddvergqvlvkpgsvkphtkftaevyvlskeeggrht
    pffkgyrpqfyfrttdvtgncelpegvemvmpgdniqmtvtliktiamedglrfairegg
    rtvgagvvakiie
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4j0qB (B:)
    mgsshhhhhhssglvprgshmasmtggqqmgrgsefmakekfdrslphvnvgtighvdhg
    kttltaaltrvcsevfgsaivefdkidsapeekargitintahveynstirhyahvdcpg
    hadyvknmitgaaqmdgailvcsaadgpmpqtrehillsrqvgvpyivvflnkadlvdda
    ellelvemevrdllstydfpgddtpiiigsarmalegkddnemgttavkklvetldsyip
    epvraidqpflmpiedvfsisgrgtvvtgriergivrvqdpleivglrdtttttctgvem
    frklldegragencgvllrgtkrddvergqvlvkpgsvkphtkftaevyvlskeeggrht
    pffkgyrpqfyfrttdvtgncelpegvemvmpgdniqmtvtliktiamedglrfairegg
    rtvgagvvakiie
    

    Sequence, based on observed residues (ATOM records): (download)
    >4j0qB (B:)
    slphvnvgtighvdhgkttltaaltrvcsevfgsargitintahveynstirhyahvdcp
    ghadyvknmitgaaqmdgailvcsaadgpmpqtrehillsrqvgvpyivvflnkadlvdd
    aellelvemevrdllstydfpgddtpiiigsarmalegkddnemgttavkklvetldsyi
    pepvraidqpflmpiedvfsisgrgtvvtgriergivrvqdpleivglrdtttttctgve
    mfrklldegragencgvllrgtkrddvergqvlvkpgsvkphtkftaevyvlskeeggrh
    tpffkgyrpqfyfrttdvtgncelpegvemvmpgdniqmtvtliktiamedglrfaireg
    grtvgagvvakiie
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >4j0qC (C:)
    mgsshhhhhhssglvprgshmasmtggqqmgrgsefmakekfdrslphvnvgtighvdhg
    kttltaaltrvcsevfgsaivefdkidsapeekargitintahveynstirhyahvdcpg
    hadyvknmitgaaqmdgailvcsaadgpmpqtrehillsrqvgvpyivvflnkadlvdda
    ellelvemevrdllstydfpgddtpiiigsarmalegkddnemgttavkklvetldsyip
    epvraidqpflmpiedvfsisgrgtvvtgriergivrvqdpleivglrdtttttctgvem
    frklldegragencgvllrgtkrddvergqvlvkpgsvkphtkftaevyvlskeeggrht
    pffkgyrpqfyfrttdvtgncelpegvemvmpgdniqmtvtliktiamedglrfairegg
    rtvgagvvakiie
    

    Sequence, based on observed residues (ATOM records): (download)
    >4j0qC (C:)
    slphvnvgtighvdhgkttltaaltrvcsevfgsagitintahveynstirhyahvdcpg
    hadyvknmitgaaqmdgailvcsaadgpmpqtrehillsrqvgvpyivvflnkadlvdda
    ellelvemevrdllstydfpgddtpiiigsarmalegkddnemgttavkklvetldsyip
    epvraidqpflmpiedvfsisgrgtvvtgriergivrvqdpleivglrdtttttctgvem
    frklldegragencgvllrgtkrddvergqvlvkpgsvkphtkftaevyvlskeeggrht
    pffkgyrpqfyfrttdvtgncelpegvemvmpgdniqmtvtliktiamedglrfairegg
    rtvgagvvakiie
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >4j0qD (D:)
    mgsshhhhhhssglvprgshmasmtggqqmgrgsefmakekfdrslphvnvgtighvdhg
    kttltaaltrvcsevfgsaivefdkidsapeekargitintahveynstirhyahvdcpg
    hadyvknmitgaaqmdgailvcsaadgpmpqtrehillsrqvgvpyivvflnkadlvdda
    ellelvemevrdllstydfpgddtpiiigsarmalegkddnemgttavkklvetldsyip
    epvraidqpflmpiedvfsisgrgtvvtgriergivrvqdpleivglrdtttttctgvem
    frklldegragencgvllrgtkrddvergqvlvkpgsvkphtkftaevyvlskeeggrht
    pffkgyrpqfyfrttdvtgncelpegvemvmpgdniqmtvtliktiamedglrfairegg
    rtvgagvvakiie
    

    Sequence, based on observed residues (ATOM records): (download)
    >4j0qD (D:)
    slphvnvgtighvdhgkttltaaltrvcsevfgsitintahveynstirhyahvdcpgha
    dyvknmitgaaqmdgailvcsaadgpmpqtrehillsrqvgvpyivvflnkadlvddael
    lelvemevrdllstydfpgddtpiiigsarmalegkddnemgttavkklvetldsyipep
    vraidqpflmpiedvfsisgrgtvvtgriergivrvqdpleivglrdtttttctgvemfr
    klldegragencgvllrgtkrddvergqvlvkpgsvkphtkftaevyvlskeeggrhtpf
    fkgyrpqfyfrttdvtgncelpegvemvmpgdniqmtvtliktiamedglrfaireggrt
    vgagvvakiie
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >4j0qE (E:)
    mgsshhhhhhssglvprgshmasmtggqqmgrgsefmakekfdrslphvnvgtighvdhg
    kttltaaltrvcsevfgsaivefdkidsapeekargitintahveynstirhyahvdcpg
    hadyvknmitgaaqmdgailvcsaadgpmpqtrehillsrqvgvpyivvflnkadlvdda
    ellelvemevrdllstydfpgddtpiiigsarmalegkddnemgttavkklvetldsyip
    epvraidqpflmpiedvfsisgrgtvvtgriergivrvqdpleivglrdtttttctgvem
    frklldegragencgvllrgtkrddvergqvlvkpgsvkphtkftaevyvlskeeggrht
    pffkgyrpqfyfrttdvtgncelpegvemvmpgdniqmtvtliktiamedglrfairegg
    rtvgagvvakiie
    

    Sequence, based on observed residues (ATOM records): (download)
    >4j0qE (E:)
    slphvnvgtighvdhgkttltaaltrvcsevfgstintahveynstirhyahvdcpghad
    yvknmitgaaqmdgailvcsaadgpmpqtrehillsrqvgvpyivvflnkadlvddaell
    elvemevrdllstydfpgddtpiiigsarmalegkddnemgttavkklvetldsyipepv
    raidqpflmpiedvfsisgrgtvvtgriergivrvqdpleivglrdtttttctgvemfrk
    lldegragencgvllrgtkrddvergqvlvkpgsvkphtkftaevyvlskeeggrhtpff
    kgyrpqfyfrttdvtgncelpegvemvmpgdniqmtvtliktiamedglrfaireggrtv
    gagvvakiie