Lineage for d4iw3k2 (4iw3 K:206-304)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1791673Fold b.43: Reductase/isomerase/elongation factor common domain [50412] (4 superfamilies)
    barrel, closed; n=6, S=10; greek-key
  4. 1791735Superfamily b.43.3: Translation proteins [50447] (7 families) (S)
  5. 1792044Family b.43.3.0: automated matches [227211] (1 protein)
    not a true family
  6. 1792045Protein automated matches [226946] (19 species)
    not a true protein
  7. 1792093Species Pseudomonas putida [TaxId:160488] [256312] (2 PDB entries)
  8. 1792100Domain d4iw3k2: 4iw3 K:206-304 [252736]
    Other proteins in same PDB: d4iw3a_, d4iw3b1, d4iw3b3, d4iw3j_, d4iw3k1, d4iw3k3
    automated match to d1b23p1
    complexed with gdp, mg, mn, oga

Details for d4iw3k2

PDB Entry: 4iw3 (more details), 2.7 Å

PDB Description: crystal structure of a pseudomonas putida prolyl-4-hydroxylase (p4h) in complex with elongation factor tu (ef-tu)
PDB Compounds: (K:) elongation factor tu-a

SCOPe Domain Sequences for d4iw3k2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4iw3k2 b.43.3.0 (K:206-304) automated matches {Pseudomonas putida [TaxId: 160488]}
pvraidqpflmpiedvfsisgrgtvvtgriergivrvqdpleivglrdtttttctgvemf
rklldegragencgvllrgtkrddvergqvlvkpgsvkp

SCOPe Domain Coordinates for d4iw3k2:

Click to download the PDB-style file with coordinates for d4iw3k2.
(The format of our PDB-style files is described here.)

Timeline for d4iw3k2: