| Class b: All beta proteins [48724] (176 folds) |
| Fold b.44: Elongation factor/aminomethyltransferase common domain [50464] (2 superfamilies) barrel, closed; n=6, S=10; greek-key |
Superfamily b.44.1: EF-Tu/eEF-1alpha/eIF2-gamma C-terminal domain [50465] (2 families) ![]() probably related to the second domain and its superfamiy by a circular permutation |
| Family b.44.1.0: automated matches [254194] (1 protein) not a true family |
| Protein automated matches [254425] (14 species) not a true protein |
| Species Pseudomonas putida [TaxId:160488] [256313] (2 PDB entries) |
| Domain d4iw3b3: 4iw3 B:305-397 [252734] Other proteins in same PDB: d4iw3a_, d4iw3b1, d4iw3b2, d4iw3j_, d4iw3k1, d4iw3k2 automated match to d1b23p2 complexed with gdp, mg, mn, oga |
PDB Entry: 4iw3 (more details), 2.7 Å
SCOPe Domain Sequences for d4iw3b3:
Sequence; same for both SEQRES and ATOM records: (download)
>d4iw3b3 b.44.1.0 (B:305-397) automated matches {Pseudomonas putida [TaxId: 160488]}
htkftaevyvlskeeggrhtpffkgyrpqfyfrttdvtgncelpegvemvmpgdniqmtv
tliktiamedglrfaireggrtvgagvvakiie
Timeline for d4iw3b3: