![]() | Class b: All beta proteins [48724] (176 folds) |
![]() | Fold b.40: OB-fold [50198] (16 superfamilies) barrel, closed or partly opened n=5, S=10 or S=8; greek-key |
![]() | Superfamily b.40.4: Nucleic acid-binding proteins [50249] (17 families) ![]() |
![]() | Family b.40.4.2: DNA helicase RuvA subunit, N-terminal domain [50259] (1 protein) barrel, closed; n=5, S=10 automatically mapped to Pfam PF01330 |
![]() | Protein DNA helicase RuvA subunit, N-terminal domain [50260] (3 species) tetramer; binds Holliday junction |
![]() | Species Escherichia coli [TaxId:562] [50261] (5 PDB entries) |
![]() | Domain d1d8lb2: 1d8l B:1-64 [25268] Other proteins in same PDB: d1d8la1, d1d8lb1 |
PDB Entry: 1d8l (more details), 2.5 Å
SCOPe Domain Sequences for d1d8lb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1d8lb2 b.40.4.2 (B:1-64) DNA helicase RuvA subunit, N-terminal domain {Escherichia coli [TaxId: 562]} migrlrgiiiekqpplvlievggvgyevhmpmtcfyelpeagqeaivfthfvvredaqll ygfn
Timeline for d1d8lb2: