Lineage for d1d8lb2 (1d8l B:1-64)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1313473Fold b.40: OB-fold [50198] (16 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 1314543Superfamily b.40.4: Nucleic acid-binding proteins [50249] (17 families) (S)
  5. 1314591Family b.40.4.2: DNA helicase RuvA subunit, N-terminal domain [50259] (1 protein)
    barrel, closed; n=5, S=10
    automatically mapped to Pfam PF01330
  6. 1314592Protein DNA helicase RuvA subunit, N-terminal domain [50260] (3 species)
    tetramer; binds Holliday junction
  7. 1314593Species Escherichia coli [TaxId:562] [50261] (5 PDB entries)
  8. 1314597Domain d1d8lb2: 1d8l B:1-64 [25268]
    Other proteins in same PDB: d1d8la1, d1d8lb1

Details for d1d8lb2

PDB Entry: 1d8l (more details), 2.5 Å

PDB Description: e. coli holliday junction binding protein ruva nh2 region lacking domain iii
PDB Compounds: (B:) protein (holliday junction DNA helicase ruva)

SCOPe Domain Sequences for d1d8lb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1d8lb2 b.40.4.2 (B:1-64) DNA helicase RuvA subunit, N-terminal domain {Escherichia coli [TaxId: 562]}
migrlrgiiiekqpplvlievggvgyevhmpmtcfyelpeagqeaivfthfvvredaqll
ygfn

SCOPe Domain Coordinates for d1d8lb2:

Click to download the PDB-style file with coordinates for d1d8lb2.
(The format of our PDB-style files is described here.)

Timeline for d1d8lb2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1d8lb1