Lineage for d1hjpa3 (1hjp A:1-64)

  1. Root: SCOPe 2.02
  2. 1103260Class b: All beta proteins [48724] (174 folds)
  3. 1123681Fold b.40: OB-fold [50198] (16 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 1124635Superfamily b.40.4: Nucleic acid-binding proteins [50249] (17 families) (S)
  5. 1124678Family b.40.4.2: DNA helicase RuvA subunit, N-terminal domain [50259] (1 protein)
    barrel, closed; n=5, S=10
  6. 1124679Protein DNA helicase RuvA subunit, N-terminal domain [50260] (3 species)
    tetramer; binds Holliday junction
  7. 1124680Species Escherichia coli [TaxId:562] [50261] (5 PDB entries)
  8. 1124682Domain d1hjpa3: 1hjp A:1-64 [25266]
    Other proteins in same PDB: d1hjpa1, d1hjpa2

Details for d1hjpa3

PDB Entry: 1hjp (more details), 2.5 Å

PDB Description: holliday junction binding protein ruva from e. coli
PDB Compounds: (A:) ruva

SCOPe Domain Sequences for d1hjpa3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hjpa3 b.40.4.2 (A:1-64) DNA helicase RuvA subunit, N-terminal domain {Escherichia coli [TaxId: 562]}
migrlrgiiiekqpplvlievggvgyevhmpmtcfyelpeagqeaivfthfvvredaqll
ygfn

SCOPe Domain Coordinates for d1hjpa3:

Click to download the PDB-style file with coordinates for d1hjpa3.
(The format of our PDB-style files is described here.)

Timeline for d1hjpa3: