Class d: Alpha and beta proteins (a+b) [53931] (380 folds) |
Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies) 4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing |
Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) N-terminal residue provides two catalytic groups, nucleophile and proton donor |
Family d.153.1.0: automated matches [191393] (1 protein) not a true family |
Protein automated matches [190509] (9 species) not a true protein |
Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [226129] (12 PDB entries) |
Domain d4inuq_: 4inu Q: [252659] Other proteins in same PDB: d4inua_, d4inub_, d4inue_, d4inug_, d4inuh_, d4inui_, d4inuj_, d4inuk_, d4inul_, d4inum_, d4inun_, d4inuo_, d4inup_, d4inus_, d4inuu_, d4inuv_, d4inuw_, d4inux_, d4inuy_, d4inuz_ automated match to d4eu2a_ complexed with 1g6 |
PDB Entry: 4inu (more details), 3.1 Å
SCOPe Domain Sequences for d4inuq_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4inuq_ d.153.1.0 (Q:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} gydralsifspdghifqveyaleavkrgtcavgvkgkncvvlgcerrstlklqdtritps kvskidshvvlsfsglnadsriliekarveaqshrltledpvtveyltryvagvqqrytq sggvrpfgvstliagfdprddepklyqtepsgiysswsaqtigrnsktvrefleknydrk eppatveecvkltvrsllevvqtgaknieitvvkpdsdivalsseeinqyvtqieqekqe q
Timeline for d4inuq_: