Lineage for d4inub_ (4inu B:)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1676433Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
    4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing
  4. 1676434Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) (S)
    N-terminal residue provides two catalytic groups, nucleophile and proton donor
  5. 1676603Family d.153.1.4: Proteasome subunits [56251] (4 proteins)
  6. 1678261Protein automated matches [190144] (7 species)
    not a true protein
  7. 1678282Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [187078] (39 PDB entries)
  8. 1678480Domain d4inub_: 4inu B: [252645]
    Other proteins in same PDB: d4inua_, d4inuc_, d4inue_, d4inuf_, d4inui_, d4inuj_, d4inuk_, d4inul_, d4inum_, d4inun_, d4inuo_, d4inuq_, d4inus_, d4inut_, d4inuw_, d4inux_, d4inuy_, d4inuz_
    automated match to d1rypc_
    complexed with 1g6

Details for d4inub_

PDB Entry: 4inu (more details), 3.1 Å

PDB Description: Yeast 20S proteasome in complex with the vinyl sulfone LU112
PDB Compounds: (B:) Proteasome component Y13

SCOPe Domain Sequences for d4inub_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4inub_ d.153.1.4 (B:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
gsrrydsrttifspegrlyqveyalesishagtaigimasdgivlaaerkvtstlleqdt
steklyklndkiavavagltadaeilintarihaqnylktynedipveilvrrlsdikqg
ytqhgglrpfgvsfiyagyddrygyqlytsnpsgnytgwkaisvgantsaaqtllqmdyk
ddmkvddaielalktlskttdssaltydrlefatirkgandgevyqkifkpqeikdilvk
tgit

SCOPe Domain Coordinates for d4inub_:

Click to download the PDB-style file with coordinates for d4inub_.
(The format of our PDB-style files is described here.)

Timeline for d4inub_: