SCOPe 2.05: Domain d4iffc_: 4iff C:

Lineage for d4iffc_ (4iff C:)

1. Root: SCOPe 2.05

2. Class h: Coiled coil proteins [57942] (7 folds)

3. Fold h.1: Parallel coiled-coil [57943] (35 superfamilies)
   this is not a true fold; includes oligomers of shorter identical helices

4. Superfamily h.1.24: Head morphogenesis protein gp7 [90246] (1 family)

5. Family h.1.24.1: Head morphogenesis protein gp7 [90247] (2 proteins)

6. Protein automated matches [254750] (1 species)
   not a true protein

7. Species Bacillus phage [TaxId:10756] [256300] (2 PDB entries)

8. Domain d4iffc_: 4iff C: [252616]
   automated match to d1no4b_
   complexed with gol

Details for d4iffc_

PDB Entry: 4iff, 2.3 Å

PDB Description: structural organization of ftsb, a transmembrane protein of the bacterial divisome

PDB Compounds: (C:) Fusion of phage phi29 Gp7 protein and Cell division protein FtsB

SCOPe Domain Sequences for d4iffc_:

Sequence; same for both SEQRES and ATOM records:

>d4iffc_ h.1.24.1 (C:) automated matches {Bacillus phage [TaxId: 10756]}
gplkpeehedilnklldpelaqsertealqqlrvnygsfvseyndltkdytrvnddvaaq
qatnaklkarndqlfaeiddln

Timeline for d4iffc_:

• d4iffc_ first appeared in SCOPe 2.04
  
• d4iffc_ is called d4iffc1 in SCOPe 2.06
  
• d4iffc_ appears in the current release, SCOPe 2.08, called d4iffc1