Class h: Coiled coil proteins [57942] (7 folds) |
Fold h.1: Parallel coiled-coil [57943] (35 superfamilies) this is not a true fold; includes oligomers of shorter identical helices |
Superfamily h.1.24: Head morphogenesis protein gp7 [90246] (1 family) |
Family h.1.24.1: Head morphogenesis protein gp7 [90247] (2 proteins) |
Protein automated matches [254750] (1 species) not a true protein |
Species Bacillus phage [TaxId:10756] [256300] (2 PDB entries) |
Domain d4iffc_: 4iff C: [252616] automated match to d1no4b_ complexed with gol |
PDB Entry: 4iff (more details), 2.3 Å
SCOPe Domain Sequences for d4iffc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4iffc_ h.1.24.1 (C:) automated matches {Bacillus phage [TaxId: 10756]} gplkpeehedilnklldpelaqsertealqqlrvnygsfvseyndltkdytrvnddvaaq qatnaklkarndqlfaeiddln
Timeline for d4iffc_: