SCOPe 2.08: Domain d4iffc1: 4iff C:2-161

Lineage for d4iffc1 (4iff C:2-161)

1. Root: SCOPe 2.08

2. Class h: Coiled coil proteins [57942] (7 folds)

3. Fold h.1: Parallel coiled-coil [57943] (41 superfamilies)
   this is not a true fold; includes oligomers of shorter identical helices

4. Superfamily h.1.24: Head morphogenesis protein gp7 [90246] (1 family)

5. Family h.1.24.1: Head morphogenesis protein gp7 [90247] (2 proteins)

6. Protein automated matches [254750] (1 species)
   not a true protein

7. Species Bacillus phage [TaxId:10756] [256300] (2 PDB entries)

8. Domain d4iffc1: 4iff C:2-161 [252616]
   Other proteins in same PDB: d4iffa2, d4iffb2, d4iffc2, d4iffd2
   automated match to d1no4b_
   complexed with gol

Details for d4iffc1

PDB Entry: 4iff, 2.3 Å

PDB Description: structural organization of ftsb, a transmembrane protein of the bacterial divisome

PDB Compounds: (C:) Fusion of phage phi29 Gp7 protein and Cell division protein FtsB

SCOPe Domain Sequences for d4iffc1:

Sequence; same for both SEQRES and ATOM records:

>d4iffc1 h.1.24.1 (C:2-161) automated matches {Bacillus phage [TaxId: 10756]}
plkpeehedilnklldpelaqsertealqqlrvnygsfvseyndltkdytrvnddvaaqq
atnaklkarndqlfaeiddln

Timeline for d4iffc1:

• d4iffc1 first appeared in SCOPe 2.04, called d4iffc_
  
• d4iffc1 appears in SCOPe 2.07