Lineage for d1no4b_ (1no4 B:)

  1. Root: SCOPe 2.05
  2. 1968223Class h: Coiled coil proteins [57942] (7 folds)
  3. 1968224Fold h.1: Parallel coiled-coil [57943] (35 superfamilies)
    this is not a true fold; includes oligomers of shorter identical helices
  4. 1969355Superfamily h.1.24: Head morphogenesis protein gp7 [90246] (1 family) (S)
  5. 1969356Family h.1.24.1: Head morphogenesis protein gp7 [90247] (2 proteins)
  6. 1969357Protein Head morphogenesis protein gp7 [90248] (1 species)
  7. 1969358Species Bacteriophage phi-29 [TaxId:10756] [90249] (2 PDB entries)
  8. 1969360Domain d1no4b_: 1no4 B: [85919]

Details for d1no4b_

PDB Entry: 1no4 (more details), 2.2 Å

PDB Description: crystal structure of the pre-assembly scaffolding protein gp7 from the double-stranded dna bacteriophage phi29
PDB Compounds: (B:) head morphogenesis protein

SCOPe Domain Sequences for d1no4b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1no4b_ h.1.24.1 (B:) Head morphogenesis protein gp7 {Bacteriophage phi-29 [TaxId: 10756]}
plkpeehedilnklldpelaqsertealqqlrvnygsfvseyndltksheklaaekddli
vsnsklfrqigltek

SCOPe Domain Coordinates for d1no4b_:

Click to download the PDB-style file with coordinates for d1no4b_.
(The format of our PDB-style files is described here.)

Timeline for d1no4b_: