SCOPe 2.06: Domain d1aszb1: 1asz B:68-204

Lineage for d1aszb1 (1asz B:68-204)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.40: OB-fold [50198] (16 superfamilies)
   barrel, closed or partly opened n=5, S=10 or S=8; greek-key

4. Superfamily b.40.4: Nucleic acid-binding proteins [50249] (17 families)

5. Family b.40.4.1: Anticodon-binding domain [50250] (2 proteins)
   barrel, closed; n=5, S=10

6. Protein Aspartyl-tRNA synthetase (AspRS) [50251] (5 species)
   this is N-terminal domain in prokaryotic enzymes and the first "visible" domain in eukaryotic enzymes

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [50252] (3 PDB entries)

8. Domain d1aszb1: 1asz B:68-204 [25241]
   Other proteins in same PDB: d1asza2, d1aszb2
   protein/RNA complex; complexed with atp

Details for d1aszb1

PDB Entry: 1asz, 3 Å

PDB Description: the active site of yeast aspartyl-trna synthetase: structural and functional aspects of the aminoacylation reaction

PDB Compounds: (B:) ASPARTYL-tRNA SYNTHETASE

SCOPe Domain Sequences for d1aszb1:

Sequence; same for both SEQRES and ATOM records:

>d1aszb1 b.40.4.1 (B:68-204) Aspartyl-tRNA synthetase (AspRS) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
edtakdnygklpliqsrdsdrtgqkrvkfvdldeakdsdkevlfrarvhntrqqgatlaf
ltlrqqasliqglvkankegtisknmvkwagslnlesivlvrgivkkvdepiksatvqnl
eihitkiytisetpeal

Timeline for d1aszb1:

• d1aszb1 first appeared (with stable ids) in SCOP 1.55
  
• d1aszb1 appears in SCOPe 2.05
  
• d1aszb1 appears in SCOPe 2.07
  
• d1aszb1 appears in the current release, SCOPe 2.08