SCOP 1.55: Domain d1aszb1: 1asz B:68-204

Lineage for d1aszb1 (1asz B:68-204)

1. Root: SCOP 1.55

2. Class b: All beta proteins [48724] (93 folds)

3. Fold b.40: OB-fold [50198] (7 superfamilies)

4. Superfamily b.40.4: Nucleic acid-binding proteins [50249] (8 families)

5. Family b.40.4.1: Anticodon-binding domain [50250] (2 proteins)

6. Protein Aspartyl-tRNA synthetase (AspRS) [50251] (4 species)

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [50252] (3 PDB entries)

8. Domain d1aszb1: 1asz B:68-204 [25241]
   Other proteins in same PDB: d1asza2, d1aszb2

Details for d1aszb1

PDB Entry: 1asz, 3 Å

PDB Description: the active site of yeast aspartyl-trna synthetase: structural and functional aspects of the aminoacylation reaction

SCOP Domain Sequences for d1aszb1:

Sequence; same for both SEQRES and ATOM records:

>d1aszb1 b.40.4.1 (B:68-204) Aspartyl-tRNA synthetase (AspRS) {Baker's yeast (Saccharomyces cerevisiae)}
edtakdnygklpliqsrdsdrtgqkrvkfvdldeakdsdkevlfrarvhntrqqgatlaf
ltlrqqasliqglvkankegtisknmvkwagslnlesivlvrgivkkvdepiksatvqnl
eihitkiytisetpeal

Timeline for d1aszb1:

• d1aszb1 appears in SCOP 1.57
  
• d1aszb1 appears in the current release, SCOPe 2.08