Lineage for d4gwya_ (4gwy A:)

  1. Root: SCOPe 2.07
  2. 2618030Class e: Multi-domain proteins (alpha and beta) [56572] (71 folds)
  3. 2621435Fold e.7: Carbohydrate phosphatase [56654] (1 superfamily)
    N-terminal domain is an alpha+beta, C-terminal domain is an alpha/beta with mixed beta-sheet
  4. 2621436Superfamily e.7.1: Carbohydrate phosphatase [56655] (3 families) (S)
  5. 2621437Family e.7.1.1: Inositol monophosphatase/fructose-1,6-bisphosphatase-like [56656] (7 proteins)
  6. 2621487Protein Fructose-1,6-bisphosphatase [56657] (7 species)
  7. 2621534Species Pig (Sus scrofa) [TaxId:9823] [56658] (65 PDB entries)
  8. 2621609Domain d4gwya_: 4gwy A: [252346]
    automated match to d1fsaa_
    complexed with amp, f6p, mg, po4

Details for d4gwya_

PDB Entry: 4gwy (more details), 3 Å

PDB Description: crystal structure of amp complexes of porcine liver fructose-1,6- bisphosphatase with blocked subunit pair rotation
PDB Compounds: (A:) Fructose-1,6-bisphosphatase 1

SCOPe Domain Sequences for d4gwya_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4gwya_ e.7.1.1 (A:) Fructose-1,6-bisphosphatase {Pig (Sus scrofa) [TaxId: 9823]}
ivtltrfvkeegrkargtgemtqllnslctavkaistavrkagiahlygiagstnvtgdq
vkkldvlsndlvinvlkssfatcvlvseedknaiivepekrgkyvvcfdpldgssnidcl
vsigtifgiyrknstdepsekdalqpgrnlvaagyalygsatmlvlamvngvncfmldpa
igefilvdrdvkikkkgsiysinegyakefdpaiteyiqrkkfppdnsapygaryvgsmv
advhrtlvyggifmypankkspkgklrllyecnpmayvmekagglattgkeavldivptd
ihqrapiilgspedvtelleiyqkha

SCOPe Domain Coordinates for d4gwya_:

Click to download the PDB-style file with coordinates for d4gwya_.
(The format of our PDB-style files is described here.)

Timeline for d4gwya_: