Lineage for d1fsaa_ (1fsa A:)
- Root: SCOPe 2.07
Class e: Multi-domain proteins (alpha and beta) [56572] (71 folds) 
Fold e.7: Carbohydrate phosphatase [56654] (1 superfamily)
N-terminal domain is an alpha+beta, C-terminal domain is an alpha/beta with mixed beta-sheetSuperfamily e.7.1: Carbohydrate phosphatase [56655] (3 families) 
Family e.7.1.1: Inositol monophosphatase/fructose-1,6-bisphosphatase-like [56656] (7 proteins) 
Protein Fructose-1,6-bisphosphatase [56657] (7 species) Species Pig (Sus scrofa) [TaxId:9823] [56658] (65 PDB entries) 
Domain d1fsaa_: 1fsa A: [42903]
complexed with amp, f6p, mn; mutant
Details for d1fsaa_
PDB Entry: 1fsa (more details), 2.3 Å
PDB Description: the t-state structure of lys 42 to ala mutant of the pig kidney fructose 1,6-bisphosphatase expressed in e. coli
PDB Compounds: (A:) fructose 1,6-bisphosphataseSCOPe Domain Sequences for d1fsaa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1fsaa_ e.7.1.1 (A:) Fructose-1,6-bisphosphatase {Pig (Sus scrofa) [TaxId: 9823]}
tdqaafdtnivtltrfvmeqgrkargtgemtqllnslctavaaistavrkagiahlygia
gstnvtgdqvkkldvlsndlvinvlkssfatcvlvteedknaiivepekrgkyvvcfdpl
dgssnidclvsigtifgiyrknstdepsekdalqpgrnlvaagyalygsatmlvlamvng
vncfmldpaigefilvdrnvkikkkgsiysinegyakefdpaiteyiqrkkfppdnsapy
garyvgsmvadvhrtlvyggifmypankkspkgklrllyecnpmayvmekagglattgke
avldivptdihqrapiilgspedvtelleiyqkhaak
SCOPe Domain Coordinates for d1fsaa_:
Click to download the PDB-style file with coordinates for d1fsaa_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1fsaa_:
View in 3D
