SCOPe 2.07: Domain d1fnwf1: 1fnw F:1501-1607

Lineage for d1fnwf1 (1fnw F:1501-1607)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.40: OB-fold [50198] (17 superfamilies)
   barrel, closed or partly opened n=5, S=10 or S=8; greek-key

4. Superfamily b.40.2: Bacterial enterotoxins [50203] (3 families)

5. Family b.40.2.2: Superantigen toxins, N-terminal domain [50219] (16 proteins)

6. Protein Streptococcal pyrogenic exotoxin A1 [50240] (1 species)

7. Species Streptococcus pyogenes [TaxId:1314] [50241] (8 PDB entries)
   Uniprot P08095

8. Domain d1fnwf1: 1fnw F:1501-1607 [25229]
   Other proteins in same PDB: d1fnwa2, d1fnwb2, d1fnwc2, d1fnwd2, d1fnwe2, d1fnwf2, d1fnwg2, d1fnwh2
   complexed with cd

Details for d1fnwf1

PDB Entry: 1fnw, 3.9 Å

PDB Description: crystal structure of streptococcal pyrogenic exotoxin a

PDB Compounds: (F:) exotoxin type a precursor (allele 1)

SCOPe Domain Sequences for d1fnwf1:

Sequence; same for both SEQRES and ATOM records:

>d1fnwf1 b.40.2.2 (F:1501-1607) Streptococcal pyrogenic exotoxin A1 {Streptococcus pyogenes [TaxId: 1314]}
qqdpdpsqlhrsslvknlqniyflyegdpvthenvksvdqllshdliynvsgpnydklkt
elknqematlfkdknvdiygveyyhlcylcenaersaciyggvtnhe

Timeline for d1fnwf1:

• d1fnwf1 first appeared (with stable ids) in SCOP 1.55
  
• d1fnwf1 appears in SCOPe 2.06
  
• d1fnwf1 appears in the current release, SCOPe 2.08