SCOPe 2.07: Domain d1fnwe2: 1fnw E:1308-1421

Lineage for d1fnwe2 (1fnw E:1308-1421)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
   core: beta(2)-alpha-beta(2); mixed beta-sheet 2143

4. Superfamily d.15.6: Superantigen toxins, C-terminal domain [54334] (2 families)

5. Family d.15.6.1: Superantigen toxins, C-terminal domain [54335] (16 proteins)

6. Protein Streptococcal pyrogenic exotoxin A1 [54356] (1 species)

7. Species Streptococcus pyogenes [TaxId:1314] [54357] (8 PDB entries)
   Uniprot P08095

8. Domain d1fnwe2: 1fnw E:1308-1421 [37817]
   Other proteins in same PDB: d1fnwa1, d1fnwb1, d1fnwc1, d1fnwd1, d1fnwe1, d1fnwf1, d1fnwg1, d1fnwh1
   complexed with cd

Details for d1fnwe2

PDB Entry: 1fnw, 3.9 Å

PDB Description: crystal structure of streptococcal pyrogenic exotoxin a

PDB Compounds: (E:) exotoxin type a precursor (allele 1)

SCOPe Domain Sequences for d1fnwe2:

Sequence; same for both SEQRES and ATOM records:

>d1fnwe2 d.15.6.1 (E:1308-1421) Streptococcal pyrogenic exotoxin A1 {Streptococcus pyogenes [TaxId: 1314]}
gnhleipkkivvkvsidgiqslsfdietnkkmvtaqeldykvrkytidnkqlytngpsky
etgyikfipknkesfwfdffpepeftqskylmiykdnetldnktsqievylttk

Timeline for d1fnwe2:

• d1fnwe2 first appeared (with stable ids) in SCOP 1.55
  
• d1fnwe2 appears in SCOPe 2.06
  
• d1fnwe2 appears in the current release, SCOPe 2.08