![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily) core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest |
![]() | Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (61 families) ![]() |
![]() | Family c.66.1.28: N6 adenine-specific DNA methylase, DAM [88788] (3 proteins) automatically mapped to Pfam PF02086 |
![]() | Protein automated matches [237125] (1 species) not a true protein |
![]() | Species Escherichia coli K-12 [TaxId:83333] [237133] (5 PDB entries) |
![]() | Domain d4gome_: 4gom E: [252247] automated match to d4gole_ protein/DNA complex; complexed with 0y0 |
PDB Entry: 4gom (more details), 2.45 Å
SCOPe Domain Sequences for d4gome_:
Sequence, based on SEQRES records: (download)
>d4gome_ c.66.1.28 (E:) automated matches {Escherichia coli K-12 [TaxId: 83333]} knraflkwaggkypllddikrhlpkgeclvepfvgagsvflntdfsryiladinsdlisl ynivkmrtdeyvqaarelfvpetncaevyyqfreefnksqdpfrravlflylnrygyngl crynlrgefnvpfgrykkpyfpeaelyhfaekaqnaffycesyadsmaraddasvvycdp pyaplsatanftayhtnsftleqqahlaeiaeglverhipvlisnhdtmltrewyqrakl hvvkvrrsissnggtrkkvdellalykp
>d4gome_ c.66.1.28 (E:) automated matches {Escherichia coli K-12 [TaxId: 83333]} knraflkwaggkypllddikrhlpkgeclvepfvgagsvflntdfsryiladinsdlisl ynivkmrtdeyvqaarelfvpetncaevyyqfreefnksqdpfrravlflylnrygyngl crynlrgefnvpfgrykkpyfpeaelyhfaekaqnaffycesyadsmaraddasvvycdp pyaplsftleqqahlaeiaeglverhipvlisnhdtmltrewyqraklhvvkvkvdella lykp
Timeline for d4gome_: