Lineage for d4gmdb_ (4gmd B:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2473887Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2473888Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) (S)
    division into families based on beta-sheet topologies
  5. 2479613Family c.37.1.0: automated matches [191323] (1 protein)
    not a true family
  6. 2479614Protein automated matches [190123] (156 species)
    not a true protein
  7. 2480760Species Pseudomonas aeruginosa, PA01 [TaxId:208964] [226294] (12 PDB entries)
  8. 2480769Domain d4gmdb_: 4gmd B: [252235]
    automated match to d3uwob_
    complexed with atm, ca, cl, gol

Details for d4gmdb_

PDB Entry: 4gmd (more details), 1.98 Å

PDB Description: The crystal structure of thymidylate kinase from Pseudomonas aeruginosa PAO1 in complex with AZT Monophosphate
PDB Compounds: (B:) thymidylate kinase

SCOPe Domain Sequences for d4gmdb_:

Sequence, based on SEQRES records: (download)

>d4gmdb_ c.37.1.0 (B:) automated matches {Pseudomonas aeruginosa, PA01 [TaxId: 208964]}
tglfvtlegpegagkstnrdylaerlrergievqltrepggtplaerirelllapsdepm
aadtelllmfaaraqhlagvirpalargavvlcdrftdatyayqgggrglpeariaales
fvqgdlrpdltlvfdlpveiglaraaargrldrfeqedrrffeavrqtylqraaqapery
qvldaglplaevqagldrllpnllerl

Sequence, based on observed residues (ATOM records): (download)

>d4gmdb_ c.37.1.0 (B:) automated matches {Pseudomonas aeruginosa, PA01 [TaxId: 208964]}
tglfvtlegpegagkstnrdylaerlrergievqltrepggtplaerirelllapsdepm
aadtelllmfaaraqhlagvirpalargavvlcdrftdatyayqgggrglpeariaales
fvqgdlrpdltlvfdlpvedrfeqedrrffeavrqtylqraaqaperyqvldaglplaev
qagldrllpnllerl

SCOPe Domain Coordinates for d4gmdb_:

Click to download the PDB-style file with coordinates for d4gmdb_.
(The format of our PDB-style files is described here.)

Timeline for d4gmdb_: