Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.58: Ferredoxin-like [54861] (62 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
Superfamily d.58.36: Nitrite/Sulfite reductase N-terminal domain-like [55124] (3 families) duplication: contains two subdomains of this fold |
Family d.58.36.0: automated matches [254283] (1 protein) not a true family |
Protein automated matches [254662] (3 species) not a true protein |
Species Escherichia coli K-12 [TaxId:83333] [256262] (3 PDB entries) |
Domain d4g39a3: 4g39 A:346-425 [252139] Other proteins in same PDB: d4g39a2, d4g39a4 automated match to d1aopa2 complexed with k, po4, sf4, srm; mutant |
PDB Entry: 4g39 (more details), 2.4 Å
SCOPe Domain Sequences for d4g39a3:
Sequence; same for both SEQRES and ATOM records: (download)
>d4g39a3 d.58.36.0 (A:346-425) automated matches {Escherichia coli K-12 [TaxId: 83333]} igwvkgiddnwhltlfiengrildyparplktglleiakihkgdfritanqnliiagvpe sekakiekiakesglmnavt
Timeline for d4g39a3: