SCOPe 2.08: Domain d4g39a4: 4g39 A:426-570

Lineage for d4g39a4 (4g39 A:426-570)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.134: Nitrite and sulphite reductase 4Fe-4S domain-like [56013] (1 superfamily)
   beta-alpha-beta-alpha-beta(3)-alpha(2,3); mixed sheet: order 12345; left-handed crossover connection between strands 1 and 2

4. Superfamily d.134.1: Nitrite and sulphite reductase 4Fe-4S domain-like [56014] (2 families)
   duplication: contains two domains of this fold

5. Family d.134.1.0: automated matches [254284] (1 protein)
   not a true family

6. Protein automated matches [254663] (3 species)
   not a true protein

7. Species Escherichia coli K-12 [TaxId:83333] [256263] (3 PDB entries)

8. Domain d4g39a4: 4g39 A:426-570 [252140]
   Other proteins in same PDB: d4g39a1, d4g39a3
   automated match to d1aopa4
   complexed with k, po4, sf4, srm; mutant

Details for d4g39a4

PDB Entry: 4g39, 2.4 Å

PDB Description: mutational analysis of sulfite reductase hemoprotein reveals the mechanism for coordinated electron and proton transfer

PDB Compounds: (A:) Sulfite reductase [NADPH] hemoprotein beta-component

SCOPe Domain Sequences for d4g39a4:

Sequence; same for both SEQRES and ATOM records:

>d4g39a4 d.134.1.0 (A:426-570) automated matches {Escherichia coli K-12 [TaxId: 83333]}
pqrensmacvsfptcplamaeaerflpsfidnidnlmakhgvsdehivmrvtgcpngcgr
amlaevglvgkapgrynlhlggnrigtriprmykenitepeilasldeligrwakereag
egfgdftvragiirpvldpardlwd

Timeline for d4g39a4:

• d4g39a4 first appeared in SCOPe 2.04
  
• d4g39a4 appears in SCOPe 2.07