Lineage for d4g39a4 (4g39 A:426-570)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2977656Fold d.134: Nitrite and sulphite reductase 4Fe-4S domain-like [56013] (1 superfamily)
    beta-alpha-beta-alpha-beta(3)-alpha(2,3); mixed sheet: order 12345; left-handed crossover connection between strands 1 and 2
  4. 2977657Superfamily d.134.1: Nitrite and sulphite reductase 4Fe-4S domain-like [56014] (2 families) (S)
    duplication: contains two domains of this fold
  5. 2977743Family d.134.1.0: automated matches [254284] (1 protein)
    not a true family
  6. 2977744Protein automated matches [254663] (3 species)
    not a true protein
  7. 2977745Species Escherichia coli K-12 [TaxId:83333] [256263] (3 PDB entries)
  8. 2977751Domain d4g39a4: 4g39 A:426-570 [252140]
    Other proteins in same PDB: d4g39a1, d4g39a3
    automated match to d1aopa4
    complexed with k, po4, sf4, srm; mutant

Details for d4g39a4

PDB Entry: 4g39 (more details), 2.4 Å

PDB Description: mutational analysis of sulfite reductase hemoprotein reveals the mechanism for coordinated electron and proton transfer
PDB Compounds: (A:) Sulfite reductase [NADPH] hemoprotein beta-component

SCOPe Domain Sequences for d4g39a4:

Sequence; same for both SEQRES and ATOM records: (download)

>d4g39a4 d.134.1.0 (A:426-570) automated matches {Escherichia coli K-12 [TaxId: 83333]}
pqrensmacvsfptcplamaeaerflpsfidnidnlmakhgvsdehivmrvtgcpngcgr
amlaevglvgkapgrynlhlggnrigtriprmykenitepeilasldeligrwakereag
egfgdftvragiirpvldpardlwd

SCOPe Domain Coordinates for d4g39a4:

Click to download the PDB-style file with coordinates for d4g39a4.
(The format of our PDB-style files is described here.)

Timeline for d4g39a4: