| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.211: HD-domain/PDEase-like [109603] (1 superfamily) multihelical; consists of two different alpha-helical bundles |
Superfamily a.211.1: HD-domain/PDEase-like [109604] (9 families) ![]() |
| Family a.211.1.2: PDEase [48548] (7 proteins) Pfam PF00233; multihelical; can be divided into three subdomains |
| Protein High-affinity cGMP-specific 3',5'-cyclic phosphodiesterase 9A, PDE9A [109942] (2 species) |
| Species Human (Homo sapiens) [TaxId:9606] [109943] (22 PDB entries) Uniprot O76083 241-566 |
| Domain d4g2lb1: 4g2l B:182-505 [252132] Other proteins in same PDB: d4g2la2, d4g2lb2 automated match to d3dy8a_ complexed with 0wl, mg, zn |
PDB Entry: 4g2l (more details), 3 Å
SCOPe Domain Sequences for d4g2lb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4g2lb1 a.211.1.2 (B:182-505) High-affinity cGMP-specific 3',5'-cyclic phosphodiesterase 9A, PDE9A {Human (Homo sapiens) [TaxId: 9606]}
typkyllspetiealrkptfdvwlwepnemlsclehmyhdlglvrdfsinpvtlrrwlfc
vhdnyrnnpfhnfrhcfcvaqmmysmvwlcslqekfsqtdililmtaaichdldhpgynn
tyqinartelavryndisplenhhcavafqilaepecnifsnippdgfkqirqgmitlil
atdmarhaeimdsfkekmenfdysneehmtllkmilikccdisnevrpmevaepwvdcll
eeyfmqsdrekseglpvapfmdrdkvtkataqigfikfvlipmfetvtklfpmveeimlq
plwesrdryeelkriddamkelqk
Timeline for d4g2lb1: