Lineage for d4fg6a_ (4fg6 A:)

  1. Root: SCOPe 2.07
  2. 2575216Class f: Membrane and cell surface proteins and peptides [56835] (60 folds)
  3. 2577647Fold f.20: Clc chloride channel [81341] (1 superfamily)
    core: 18 transmembrane helices
  4. 2577648Superfamily f.20.1: Clc chloride channel [81340] (1 family) (S)
  5. 2577649Family f.20.1.1: Clc chloride channel [69912] (2 proteins)
    duplication: consist of two similar structural parts
  6. 2577697Protein automated matches [226846] (3 species)
    not a true protein
  7. 2577698Species Escherichia coli K-12 [TaxId:83333] [224947] (14 PDB entries)
  8. 2577721Domain d4fg6a_: 4fg6 A: [251964]
    Other proteins in same PDB: d4fg6d1, d4fg6d2, d4fg6f1, d4fg6f2
    automated match to d1kpla_
    mutant

Details for d4fg6a_

PDB Entry: 4fg6 (more details), 3.02 Å

PDB Description: structure of ecclc e148a mutant in glutamate
PDB Compounds: (A:) H(+)/Cl(-) exchange transporter clcA

SCOPe Domain Sequences for d4fg6a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4fg6a_ f.20.1.1 (A:) automated matches {Escherichia coli K-12 [TaxId: 83333]}
rrrqlirqllerdktplailfmaavvgtlvglaavafdkgvawlqnqrmgalvhtadnyp
llltvaflcsavlamfgyflvrkyapeaggsgipeiegaledqrpvrwwrvlpvkffggl
gtlgggmvlgragptvqiggnigrmvldifrlkgdearhtllatgaaaglaaafnaplag
ilfiieemrpqfrytlisikavfigvimstimyrifnhevalidvgklsdaplntlwlyl
ilgiifgifgpifnkwvlgmqdllhrvhggnitkwvlmggaigglcgllgfvapatsggg
fnlipiatagnfsmgmlvfifvarvittllcfssgapggifapmlalgtvlgtafgmvav
elfpqyhleagtfaiagmgallaasirapltgiilvlemtdnyqlilpmiitglgatlla
qftggkplysailartlakqeaeq

SCOPe Domain Coordinates for d4fg6a_:

Click to download the PDB-style file with coordinates for d4fg6a_.
(The format of our PDB-style files is described here.)

Timeline for d4fg6a_: