PDB entry 4fg6

View 4fg6 on RCSB PDB site
Description: Structure of EcCLC E148A mutant in Glutamate
Class: transport protein
Keywords: transporter, Membrane, transport protein
Deposited on 2012-06-04, released 2012-07-04
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-08, with a file datestamp of 2017-11-03.
Experiment type: XRAY
Resolution: 3.02 Å
R-factor: N/A
AEROSPACI score: 0.13 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: H(+)/Cl(-) exchange transporter clcA
    Species: Escherichia coli K-12 [TaxId:83333]
    Gene: b0155, clcA, eriC, JW5012, SSON_0167, yadQ
    Database cross-references and differences (RAF-indexed):
    • Uniprot P37019
      • conflict (147)
    Domains in SCOPe 2.07: d4fg6a_
  • Chain 'B':
    Compound: H(+)/Cl(-) exchange transporter clcA
    Species: Escherichia coli K-12 [TaxId:83333]
    Gene: b0155, clcA, eriC, JW5012, SSON_0167, yadQ
    Database cross-references and differences (RAF-indexed):
    • Uniprot P37019
      • conflict (147)
    Domains in SCOPe 2.07: d4fg6b_
  • Chain 'C':
    Compound: Fab Fragment (Heavy Chain)
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 4FG6 (Start-221)
  • Chain 'D':
    Compound: Fab Fragment (Light Chain)
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 4FG6 (0-210)
    Domains in SCOPe 2.07: d4fg6d1, d4fg6d2
  • Chain 'E':
    Compound: Fab Fragment (Heavy Chain)
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 4FG6 (Start-221)
  • Chain 'F':
    Compound: Fab Fragment (Light Chain)
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 4FG6 (0-210)
    Domains in SCOPe 2.07: d4fg6f1, d4fg6f2

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4fg6A (A:)
    mktdtpsletpqaarlrrrqlirqllerdktplailfmaavvgtlvglaavafdkgvawl
    qnqrmgalvhtadnypllltvaflcsavlamfgyflvrkyapeaggsgipeiegaledqr
    pvrwwrvlpvkffgglgtlgggmvlgragptvqiggnigrmvldifrlkgdearhtllat
    gaaaglaaafnaplagilfiieemrpqfrytlisikavfigvimstimyrifnhevalid
    vgklsdaplntlwlylilgiifgifgpifnkwvlgmqdllhrvhggnitkwvlmggaigg
    lcgllgfvapatsgggfnlipiatagnfsmgmlvfifvarvittllcfssgapggifapm
    lalgtvlgtafgmvavelfpqyhleagtfaiagmgallaasirapltgiilvlemtdnyq
    lilpmiitglgatllaqftggkplysailartlakqeaeqlarsk
    

    Sequence, based on observed residues (ATOM records): (download)
    >4fg6A (A:)
    rrrqlirqllerdktplailfmaavvgtlvglaavafdkgvawlqnqrmgalvhtadnyp
    llltvaflcsavlamfgyflvrkyapeaggsgipeiegaledqrpvrwwrvlpvkffggl
    gtlgggmvlgragptvqiggnigrmvldifrlkgdearhtllatgaaaglaaafnaplag
    ilfiieemrpqfrytlisikavfigvimstimyrifnhevalidvgklsdaplntlwlyl
    ilgiifgifgpifnkwvlgmqdllhrvhggnitkwvlmggaigglcgllgfvapatsggg
    fnlipiatagnfsmgmlvfifvarvittllcfssgapggifapmlalgtvlgtafgmvav
    elfpqyhleagtfaiagmgallaasirapltgiilvlemtdnyqlilpmiitglgatlla
    qftggkplysailartlakqeaeq
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4fg6B (B:)
    mktdtpsletpqaarlrrrqlirqllerdktplailfmaavvgtlvglaavafdkgvawl
    qnqrmgalvhtadnypllltvaflcsavlamfgyflvrkyapeaggsgipeiegaledqr
    pvrwwrvlpvkffgglgtlgggmvlgragptvqiggnigrmvldifrlkgdearhtllat
    gaaaglaaafnaplagilfiieemrpqfrytlisikavfigvimstimyrifnhevalid
    vgklsdaplntlwlylilgiifgifgpifnkwvlgmqdllhrvhggnitkwvlmggaigg
    lcgllgfvapatsgggfnlipiatagnfsmgmlvfifvarvittllcfssgapggifapm
    lalgtvlgtafgmvavelfpqyhleagtfaiagmgallaasirapltgiilvlemtdnyq
    lilpmiitglgatllaqftggkplysailartlakqeaeqlarsk
    

    Sequence, based on observed residues (ATOM records): (download)
    >4fg6B (B:)
    rrqlirqllerdktplailfmaavvgtlvglaavafdkgvawlqnqrmgalvhtadnypl
    lltvaflcsavlamfgyflvrkyapeaggsgipeiegaledqrpvrwwrvlpvkffgglg
    tlgggmvlgragptvqiggnigrmvldifrlkgdearhtllatgaaaglaaafnaplagi
    lfiieemrpqfrytlisikavfigvimstimyrifnhevalidvgklsdaplntlwlyli
    lgiifgifgpifnkwvlgmqdllhrvhggnitkwvlmggaigglcgllgfvapatsgggf
    nlipiatagnfsmgmlvfifvarvittllcfssgapggifapmlalgtvlgtafgmvave
    lfpqyhleagtfaiagmgallaasirapltgiilvlemtdnyqlilpmiitglgatllaq
    ftggkplysailartlakqea
    

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4fg6D (D:)
    divltqspaimsaapgdkvtmtcsasssvsyihwyqqksgtspkrwiydtskltsgvpvr
    fsgsgsgtsysltintmeaedaatyycqqwsshpqtfgggtkleilradaaptvsifpps
    seqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysmsstltl
    tkdeyerhnsytceathktstspivksfnra
    

  • Chain 'E':
    No sequence available.

  • Chain 'F':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4fg6F (F:)
    divltqspaimsaapgdkvtmtcsasssvsyihwyqqksgtspkrwiydtskltsgvpvr
    fsgsgsgtsysltintmeaedaatyycqqwsshpqtfgggtkleilradaaptvsifpps
    seqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysmsstltl
    tkdeyerhnsytceathktstspivksfnra