Lineage for d1se3_1 (1se3 1-121)
- Root: SCOP 1.61
Class b: All beta proteins [48724] (111 folds) 
Fold b.40: OB-fold [50198] (8 superfamilies) 
Superfamily b.40.2: Bacterial enterotoxins [50203] (2 families) 
Family b.40.2.2: Superantigen toxins, N-terminal domain [50219] (12 proteins) Protein Staphylococcal enterotoxin B, SEB [50226] (1 species) Species Staphylococcus aureus [TaxId:1280] [50227] (13 PDB entries) 
Domain d1se3_1: 1se3 1-121 [25189]
Other proteins in same PDB: d1se3_2
Details for d1se3_1
PDB Entry: 1se3 (more details), 2.3 Å
PDB Description: staphylococcal enterotoxin b complexed with gm3 trisaccharide
SCOP Domain Sequences for d1se3_1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1se3_1 b.40.2.2 (1-121) Staphylococcal enterotoxin B, SEB {Staphylococcus aureus}
esqpdpkpdelhksskftglmenmkvlyddnhvsainvksidqflyfdliysikdtklgn
ydnvrvefknkdladkykdkyvdvfganyyyqcyfskktndinshqtdkrktcmyggvte
h
SCOP Domain Coordinates for d1se3_1:
Click to download the PDB-style file with coordinates for d1se3_1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1se3_1:
- d1se3_1 first appeared (with stable ids) in SCOP 1.55
- d1se3_1 appears in SCOP 1.59
- d1se3_1 appears in SCOP 1.63
- d1se3_1 appears in the current release, SCOPe 2.08, called d1se3a1
View in 3D
