Lineage for d1se3_1 (1se3 1-121)

  1. Root: SCOP 1.63
  2. 218896Class b: All beta proteins [48724] (119 folds)
  3. 228551Fold b.40: OB-fold [50198] (9 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 228613Superfamily b.40.2: Bacterial enterotoxins [50203] (2 families) (S)
  5. 228945Family b.40.2.2: Superantigen toxins, N-terminal domain [50219] (12 proteins)
  6. 228958Protein Staphylococcal enterotoxin B, SEB [50226] (1 species)
  7. 228959Species Staphylococcus aureus [TaxId:1280] [50227] (13 PDB entries)
  8. 228971Domain d1se3_1: 1se3 1-121 [25189]
    Other proteins in same PDB: d1se3_2
    complexed with gal, glc, sia

Details for d1se3_1

PDB Entry: 1se3 (more details), 2.3 Å

PDB Description: staphylococcal enterotoxin b complexed with gm3 trisaccharide

SCOP Domain Sequences for d1se3_1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1se3_1 b.40.2.2 (1-121) Staphylococcal enterotoxin B, SEB {Staphylococcus aureus}
esqpdpkpdelhksskftglmenmkvlyddnhvsainvksidqflyfdliysikdtklgn
ydnvrvefknkdladkykdkyvdvfganyyyqcyfskktndinshqtdkrktcmyggvte
h

SCOP Domain Coordinates for d1se3_1:

Click to download the PDB-style file with coordinates for d1se3_1.
(The format of our PDB-style files is described here.)

Timeline for d1se3_1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1se3_2