Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
Fold d.169: C-type lectin-like [56435] (1 superfamily) unusual fold |
Superfamily d.169.1: C-type lectin-like [56436] (9 families) |
Family d.169.1.1: C-type lectin domain [56437] (29 proteins) Pfam PF00059 |
Protein Low affinity immunoglobulin epsilon Fc receptor [143957] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [143958] (14 PDB entries) Uniprot P06734 156-298 |
Domain d4ezml_: 4ezm L: [251862] Other proteins in same PDB: d4ezma1, d4ezma2, d4ezmb1, d4ezmb2, d4ezmc1, d4ezmc2, d4ezmd1, d4ezmd2, d4ezme1, d4ezme2, d4ezmf1, d4ezmf2 automated match to d1t8ca1 complexed with man |
PDB Entry: 4ezm (more details), 3.1 Å
SCOPe Domain Sequences for d4ezml_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4ezml_ d.169.1.1 (L:) Low affinity immunoglobulin epsilon Fc receptor {Human (Homo sapiens) [TaxId: 9606]} fvcntcpekwinfqrkcyyfgkgtkqwvharyacddmegqlvsihspeeqdfltkhasht gswiglrnldlkgefiwvdgshvdysnwapgeptsrsqgedcvmmrgsgrwndafcdrkl gawvcdrlatctpp
Timeline for d4ezml_: