Lineage for d4ezmf2 (4ezm F:437-542)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2352459Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2352460Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2365354Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2365355Protein automated matches [190740] (29 species)
    not a true protein
  7. 2365565Species Human (Homo sapiens) [TaxId:9606] [187920] (1626 PDB entries)
  8. 2368791Domain d4ezmf2: 4ezm F:437-542 [251856]
    Other proteins in same PDB: d4ezmg_, d4ezmh_, d4ezmi_, d4ezmj_, d4ezmk_, d4ezml_
    automated match to d3zo0a2
    complexed with man

Details for d4ezmf2

PDB Entry: 4ezm (more details), 3.1 Å

PDB Description: crystal structure of the human ige-fc(epsilon)3-4 bound to its b cell receptor dercd23
PDB Compounds: (F:) ig epsilon chain c region

SCOPe Domain Sequences for d4ezmf2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4ezmf2 b.1.1.0 (F:437-542) automated matches {Human (Homo sapiens) [TaxId: 9606]}
sgpraapevyafatpewpgsrdkrtlacliqnfmpedisvqwlhnevqlpdarhsttqpr
ktkgsgffvfsrlevtraeweqkdeficravheaaspsqtvqravs

SCOPe Domain Coordinates for d4ezmf2:

Click to download the PDB-style file with coordinates for d4ezmf2.
(The format of our PDB-style files is described here.)

Timeline for d4ezmf2: