Lineage for d4ez9d1 (4ez9 D:298-468)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1605035Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 1606596Superfamily c.55.3: Ribonuclease H-like [53098] (15 families) (S)
    consists of one domain of this fold
  5. 1607696Family c.55.3.0: automated matches [191357] (1 protein)
    not a true family
  6. 1607697Protein automated matches [190396] (26 species)
    not a true protein
  7. 1607715Species Geobacillus kaustophilus [TaxId:1462] [233272] (8 PDB entries)
  8. 1607721Domain d4ez9d1: 4ez9 D:298-468 [251831]
    Other proteins in same PDB: d4ez9a2, d4ez9d2
    automated match to d3pv8d1
    protein/DNA complex; complexed with d3t, mpd, so4

Details for d4ez9d1

PDB Entry: 4ez9 (more details), 1.64 Å

PDB Description: Bacillus DNA Polymerase I Large Fragment Complex 2
PDB Compounds: (D:) DNA polymerase

SCOPe Domain Sequences for d4ez9d1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4ez9d1 c.55.3.0 (D:298-468) automated matches {Geobacillus kaustophilus [TaxId: 1462]}
kmaftladrvteemladkaalvvevveenyhdapivgiavvnehgrfflrpetaladpqf
vawlgdetkkksmfdskraavalkwkgielcgvsfdlllaaylldpaqgvddvaaaakmk
qyeavrpdeavygkgakravpdepvlaehlvrkaaaiwelerpfldelrrn

SCOPe Domain Coordinates for d4ez9d1:

Click to download the PDB-style file with coordinates for d4ez9d1.
(The format of our PDB-style files is described here.)

Timeline for d4ez9d1:

View in 3D
Domains from same chain:
(mouse over for more information)
d4ez9d2